KEGG   Variovorax paradoxus EPS: Varpa_5498Help
Entry
Varpa_5498        CDS       T01392                                 

Definition
(GenBank) ATP dependent DNA ligase
  KO
K10747  DNA ligase 1 [EC:6.5.1.1 6.5.1.6 6.5.1.7]
Organism
vpe  Variovorax paradoxus EPS
Pathway
vpe03030  DNA replication
vpe03410  Base excision repair
vpe03420  Nucleotide excision repair
vpe03430  Mismatch repair
Brite
KEGG Orthology (KO) [BR:vpe00001]
 Genetic Information Processing
  Replication and repair
   03030 DNA replication
    Varpa_5498
   03410 Base excision repair
    Varpa_5498
   03420 Nucleotide excision repair
    Varpa_5498
   03430 Mismatch repair
    Varpa_5498
Enzymes [BR:vpe01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     Varpa_5498
    6.5.1.6  DNA ligase (ATP or NAD+)
     Varpa_5498
    6.5.1.7  DNA ligase (ATP, ADP or GTP)
     Varpa_5498
DNA replication proteins [BR:vpe03032]
 Eukaryotic Type
  DNA Replication Elongation Factors
   Other elongation factors
    Varpa_5498
 Prokaryotic Type
   Elongation factors (archaeal)
    Other elongation factors
     Varpa_5498
DNA repair and recombination proteins [BR:vpe03400]
 Eukaryotic Type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    Long Patch-BER factors
     Varpa_5498
   NER (nucleotide excision repair)
    Other NER factors
     Varpa_5498
   MMR (mismatch exicision repair)
    Other MMR factors
     Varpa_5498
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DNA_ligase_A_M DNA_ligase_A_N DNA_ligase_A_C
Motif
Other DBs
NCBI-ProteinID: ADU39653
UniProt: E6V9G9
LinkDB All DBs
Position
complement(5979701..5981356)
Genome map
AA seq 551 aa AA seqDB search
MKDFAALYRELDASTSNLVKQAALQRYLRNADAADAAWAVYFLAGGKPRQLVPTKLLRLL
AQEAAGLPEWLFDESYDAVGDLAETIALLLPPPSEVHDLGLAAWVEQHLLPLREAAKTAP
EELADRLRAQWRQLAAEERLVYFKLITGAFRVGVSKLQVTQALAAVGGIDAKRVAQRLMG
YTHIGARPRAGDYATLIAPESDSEQVQKTSGQPYPFFLAHPFNIPLEQFDAVLGPPADWI
VEWKWDGIRAQLVKRAGVVWLWSRGEELVTDRFPELAVLGEALPDGTVLDGEIAVWREDK
VQPFAELQKRIGRKTLGAKLLRDIPVVLLAYDILEWEGRDLRTEPQSARRMLLDDLVTRM
QHPSLLPSPMLTGLDWSDLARQREAARTMGVEGMMLKRRDSQYGVGRTKDVGVWWKWKID
PLSIDAVLIYAQRGHGRRASLFSDYTFAVWDGPPEQEDRKLVPFAKAYSGLTDAEMARVD
AIIRKTTVESFGPVKSVKPTLVFELGFEGIARSTRHKSGIAVRFPRMLRWREDKPVAEAD
TLQTLAALLPS
NT seq 1656 nt NT seq  +upstreamnt  +downstreamnt
atgaaggacttcgccgcgctctaccgagaactcgacgcgagcacgtcgaacctcgtgaag
caggccgcgctacagcgctacctgcgcaacgccgacgcggccgatgccgcgtgggccgtc
tacttcctcgccggcggcaagccgcgccagctcgtgcccaccaagctgctgcgcctcctc
gcgcaggaagccgcgggcctgcccgagtggctgttcgacgagagctacgacgcggtcggc
gatcttgccgagaccatcgcgctcctgctgccgccgccgagcgaagtgcacgacctcggg
ctcgcggcctgggtcgagcagcatctgctgccgctgcgcgaggccgcgaagaccgcgccg
gaagaactggcggaccggctgcgcgcgcagtggcggcagctcgcggccgaggagcggctg
gtgtacttcaagctcatcaccggcgcgttccgcgtcggtgtgtcgaagctgcaggtcacg
caggcgctcgcggccgtgggcggcatcgatgccaagcgcgtcgcgcagcggctcatgggc
tacacgcacatcggcgcacggccgcgggcgggcgactacgccacgctgattgcgccggag
tccgattcggagcaggtgcagaagaccagcggccagccgtacccgttcttcctcgcgcac
ccgttcaacattccgctagaacagttcgatgcggtgctgggcccgccggccgactggatc
gtggagtggaagtgggatggcatccgcgcgcagcttgtcaagcgcgcgggcgtggtgtgg
ctgtggtcgcgtggagaagaactcgtgactgatcgctttcccgaactcgcggtgctcggc
gaggcgctgcccgatggcacagtactcgatggcgagatcgcggtctggcgtgaagacaag
gtgcagcctttcgccgaactgcagaagcgcatcggccgcaagacgctgggcgcgaagctg
ctgcgcgacattcccgtggtgctgctggcctacgacatcctcgaatgggaagggcgtgat
ttgcgcacggagccgcagtcggcgcgccgcatgctgctcgacgacctcgtcacgcgcatg
cagcatccgtcgctgctgcccagcccgatgctcaccggcctcgactggagcgatctcgcg
cggcagcgcgaagcggcgcgcaccatgggcgtcgaaggaatgatgctcaagcgccgtgac
tcgcagtacggcgtgggccgcacgaaggacgtgggcgtgtggtggaagtggaagatcgat
ccgctcagcatcgatgccgtgctcatctacgcgcagcgcgggcacggccgccgcgcaagc
ctcttcagcgactacaccttcgcggtgtgggacggtccgcctgaacaagaggaccgcaag
ctcgtgccgttcgccaaggcctactcggggctcaccgatgcggagatggcgcgcgtggac
gcgatcatccgcaagaccacggtcgagagcttcgggccggtgaagagcgtgaagccgacg
ctggtgttcgagctggggttcgaaggcatcgcgcgcagcacgcggcacaagagcggcatc
gcggtgcgctttccgcgcatgctgcgctggcgggaagacaagccggtggcggaagccgac
acgctgcagacgctggctgcgctgctgccgtcatga

DBGET integrated database retrieval system