KEGG   Variovorax paradoxus EPS: Varpa_5701Help
Entry
Varpa_5701        CDS       T01392                                 

Definition
(GenBank) Superoxide dismutase
  KO
K04564  superoxide dismutase, Fe-Mn family [EC:1.15.1.1]
Organism
vpe  Variovorax paradoxus EPS
Brite
Enzymes [BR:vpe01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     Varpa_5701
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sod_Fe_C Sod_Fe_N DUF2683
Motif
Other DBs
NCBI-ProteinID: ADU39854
UniProt: E6UVI9
LinkDB All DBs
Position
6195270..6195851
Genome map
AA seq 193 aa AA seqDB search
MEHKLPPLPYALDALAPEYSQETLEYHYGKHHNAYVVNLNNLQKGTEFEALTLEEIIKKA
SGGIYNNAAQIWNHTFFWNCMKPQGGGAPTGALAKAIDAKWGSYDAFKEAFVKSAVGNFG
SGWTWLVKKADGSVDIVNTGAAGTPLTTADTALLTVDVWEHAYYIDYRNLRPKFVETFLA
KLVNWDFAAKNFG
NT seq 582 nt NT seq  +upstreamnt  +downstreamnt
atggaacacaagctcccacccctgccctacgccctggacgcgctggcacccgagtactcg
caagagacgctcgaataccactatggcaagcatcacaacgcctacgtggtgaacctcaac
aacctgcagaagggcaccgagttcgaagccctcacgctggaagaaatcatcaagaaggcc
agcggcggcatctacaacaacgctgcgcagatctggaaccacaccttcttctggaactgc
atgaagccccaaggcggcggtgcccccaccggcgcgctggccaaggccatcgatgcgaag
tggggcagctacgacgccttcaaggaagccttcgtgaagtccgccgttggcaacttcggt
tcgggctggacgtggctcgtgaagaaggccgacggttcggtggacatcgtgaacaccggc
gccgccggcacgccgctgacgaccgctgacacggccctgctgaccgtggacgtttgggaa
cacgcctactacatcgactatcgcaacctgcgccccaagttcgtcgagaccttcctggcc
aagctcgtgaactgggacttcgcggcgaagaacttcggttga

DBGET integrated database retrieval system