KEGG   Variovorax paradoxus EPS: Varpa_5991Help
Entry
Varpa_5991        CDS       T01392                                 

Definition
(GenBank) malic protein NAD-binding protein
  KO
K00029  malate dehydrogenase (oxaloacetate-decarboxylating)(NADP+) [EC:1.1.1.40]
Organism
vpe  Variovorax paradoxus EPS
Pathway
vpe00620  Pyruvate metabolism
vpe00710  Carbon fixation in photosynthetic organisms
vpe01100  Metabolic pathways
vpe01120  Microbial metabolism in diverse environments
vpe01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:vpe00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    Varpa_5991
  09102 Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    Varpa_5991
Enzymes [BR:vpe01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.40  malate dehydrogenase (oxaloacetate-decarboxylating) (NADP+)
     Varpa_5991
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PTA_PTB malic Malic_M Malate_DH
Motif
Other DBs
NCBI-ProteinID: ADU40143
UniProt: E6V034
LinkDB All DBs
Position
6516113..6518461
Genome map
AA seq 782 aa AA seqDB search
MSDSTPSTSSTPTPEDKRAELRRAALEYHEFPVPGKIAIAATKQMVNQRDLSLAYSPGVA
APCEEIVKDPANAFKYTSRGNLVGVISNGTAVLGLGDIGPLASKPVMEGKGVLFKKFAGV
DVFDIEIDEKDPVKLVEIIAALEPTFGAINLEDIKAPDCFYVERELRKRMKIPVFHDDQH
GTAITVAAAMLNGLKVAGKNIAEVKLVTSGAGAAALACLNLLLKVGLKRENVFVTDLAGV
VYEGREELMDDDKRQYMQKTDMRKLAEVIAGADVFLGLSAGGVLKPEMVAKMAPRPVIFA
LANPNPEINPEDARAVRDDVIMATGRTDYPNQVNNVLCFPYIFRGALDSGATTITDEMEI
AAVHAIADLAQAEQSERVAAAYVGEKLSFGPEYLIPKPFDPRLMMKIAPAVAKAAEESGV
ALRPIKDMDAYRDKLQNFVYASGTTMKPIFEAARRASKKRVAYCEGEEERVLRAAQIVVD
EGIARPTLIGRPAIIAQRIEKFGLRLKEELDYDIVNVEQDHRYRDFWQTYHRMTERKGQT
VQTAKIEMRRRLTLIGAMLLHKDEVDGMICGTWGTTLIHLHYIDQVIGKRPGGCESTPQD
VPVYACMNGLLLPDRQVFLVDTHVNYDPSPEELAEITTMAAEEMMRFGLKPKAALLSHSN
FGTSNEPSAIKMRKTLDLLRVQAPWLEVDGEMHGDVALDSKQRAVVMPHSALAGDANLLV
FPNIDAANISYNLLKTAAGGNIAIGPVLLGAAKPVHILTASATVRRIVNMTALTVADANA
ER
NT seq 2349 nt NT seq  +upstreamnt  +downstreamnt
atgtcagattcgaccccctcgacctcatcgactcccacgcccgaagacaagcgcgcagaa
ctgcgccgtgccgccctcgagtaccacgagtttcccgttcccggcaagatcgccatcgcg
gcgaccaagcagatggtcaaccagcgcgacctgtcgctggcctactcgcccggcgtggcc
gcgccctgcgaggaaatcgtcaaggacccggccaacgcattcaagtacacctcgcgcggc
aatctggtgggcgtcatcagcaacggcaccgcggtgctcggcctcggcgacatcggtccg
ctggcctccaagccggtgatggaaggcaagggcgttctcttcaagaaattcgcgggcgtc
gatgtgttcgacatcgagatcgacgagaaagacccggtcaagctggtcgagatcatcgcc
gcgctggagccgaccttcggcgccatcaacctggaagacatcaaggccccggactgcttc
tacgtcgagcgcgaactgcgcaagcgcatgaagatcccggtgttccacgacgaccagcac
ggcacggccatcacggtggcggccgccatgctcaacggcctgaaggtggcgggcaagaac
atcgccgaggtcaagctggtcacctcgggcgcgggcgccgcggcgctggcctgcctgaac
ctgctgctcaaggtgggcctcaaacgcgagaacgtgttcgtcaccgacctggctggcgtg
gtctacgaaggccgcgaagagctgatggacgacgacaagcgccagtacatgcagaagacc
gacatgcgcaagctggcggaagtgatcgccggcgccgacgttttcctcggcctctcggcc
ggcggcgtgctcaagcccgagatggtcgccaagatggcgccgcgccccgtgatcttcgcg
ctggccaaccccaaccccgagatcaaccccgaagacgcccgcgcggttcgcgacgatgtg
atcatggccacgggccgcaccgattacccgaaccaggtcaacaacgtcctgtgcttcccg
tacatcttccgcggcgcgctcgactcgggcgcgaccacgatcaccgacgagatggaaatc
gccgcggtgcacgccatcgccgacctggcgcaggccgagcagagcgagcgcgtggctgcc
gcctacgtcggtgaaaagctgtccttcggccccgaatacctgattccgaagcccttcgat
ccgcgtctgatgatgaagatcgcgccggcggtggccaaggcggccgaggaaagcggcgtg
gcgctgcgtccgatcaaggacatggatgcctaccgcgacaagctgcagaacttcgtctat
gcctcgggcacgacgatgaagccgatcttcgaagcggcccgccgcgcctcgaagaaacgc
gtggcgtactgcgaaggcgaggaagaacgcgtgctgcgcgccgcgcagatcgtggtcgac
gagggcatcgcccgcccgacgctgatcggccgtccggccatcatcgcccagcgcatcgag
aagttcggcctgcgcctgaaggaagagctcgactacgacatcgtcaacgtcgagcaggac
caccgctaccgcgacttctggcagacctaccaccgcatgaccgagcgcaagggtcagacg
gtgcagaccgccaagatcgagatgcgccgccgcctcacgctgatcggcgcgatgctgctg
cacaaggacgaggtcgacggcatgatctgcggcacctggggcaccacgctgatccacctg
cactacatcgaccaggtgatcggcaagcgccccggcggctgcgagagcaccccgcaggac
gtgccggtgtacgcctgcatgaacggcctgctgctgcccgaccgccaggtgttcctggtc
gacacgcacgtcaactacgacccctcgcccgaggaactggccgagatcacgacgatggcg
gccgaggaaatgatgcgtttcggcctgaagccgaaggcagcgctgctgtcgcattcgaac
ttcggcaccagcaacgaaccgagcgccatcaagatgcgcaagacgctcgacctcttgcgc
gtgcaggcgccctggctcgaagtggacggcgaaatgcacggcgatgtggccctggacagc
aagcagcgcgcggtcgtcatgccacacagcgcgctggccggtgacgccaatctgttggtt
tttccgaacatcgacgcagccaatatttcgtacaacctgctcaagacagcggcgggcggc
aacatcgcgatcgggccggtgctgctcggcgcggccaaacctgtgcacattctcacggcc
agcgcgaccgttcgccgcatcgtgaacatgacagccttgacagtggctgacgcaaacgcc
gagagatag

DBGET integrated database retrieval system