KEGG   Vibrio parahaemolyticus O1 Kuk FDA_R31: M634_06235Help
Entry
M634_06235        CDS       T02761                                 

Gene name
sdhA
Definition
(GenBank) succinate dehydrogenase flavoprotein subunit
  KO
K00239  succinate dehydrogenase / fumarate reductase, flavoprotein subunit [EC:1.3.5.1 1.3.5.4]
Organism
vpf  Vibrio parahaemolyticus O1:Kuk FDA_R31
Pathway
vpf00020  Citrate cycle (TCA cycle)
vpf00190  Oxidative phosphorylation
vpf00650  Butanoate metabolism
vpf01100  Metabolic pathways
vpf01110  Biosynthesis of secondary metabolites
vpf01120  Microbial metabolism in diverse environments
vpf01130  Biosynthesis of antibiotics
vpf01200  Carbon metabolism
Module
vpf_M00009  Citrate cycle (TCA cycle, Krebs cycle)
vpf_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
vpf_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:vpf00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    M634_06235 (sdhA)
   00650 Butanoate metabolism
    M634_06235 (sdhA)
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    M634_06235 (sdhA)
Enzymes [BR:vpf01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     M634_06235 (sdhA)
    1.3.5.4  fumarate reductase (quinol)
     M634_06235 (sdhA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FAD_binding_2 Succ_DH_flav_C GIDA Pyr_redox_2 Thi4 HI0933_like FAD_binding_3 DAO BEX
Motif
Other DBs
NCBI-ProteinID: AGQ90400
UniProt: S5IR08
LinkDB All DBs
Position
I:1272457..1274223
Genome map
AA seq 588 aa AA seqDB search
MSIPVREFDAVVIGAGGAGMRAALQISEQGLSCALLSKVFPTRSHTVSAQGGITVALGNS
HKDDWQWHMYDTVKGSDYIGDQNAIEYMCKNGPESVIELEKMGLPFSRFDNGTIYQRPFG
GQSKEFGGEQAARTAAAADRTGHALLHTLYQQNVKHKTTIFSEWYALDLVKNQDGAIMGC
TAICMETGEICYFKSKATILATGGAGRIYASTTNAHINTGDGVGMALRAGVPMQDMEMWQ
FHPTGIAGAGVLVTEGCRGEGGYLLNKDGERFMERYAPNAKDLAGRDVVARSMMIEIREG
RGCDGPWGPHIKLKLDHLGKEVLESRLPGICELSRTFAHVDPVKEPIPVIPTCHYMMGGV
PTQVSGQAIKQLADGSEAEVQGLYACGEIASVSVHGANRLGGNSLLDLVVFGRATGLHLG
ETLAAQVEARPATESDIEASLARTMRWENSTGGEDPVQIRKDLQRCMQNSFSVFREGDAM
ATGLEELKVIRERLKDAHLADKSSEFNTQRIECLELDNLMETAFSTAVAANYRTESRGAH
ARFDFPERDDENWLCHSIYNPETEAMTKRDVNMTPVHRDAFPPKVRTY
NT seq 1767 nt NT seq  +upstreamnt  +downstreamnt
gtgtctattccagttcgtgagtttgatgccgtagtaatcggcgctggtggtgcaggtatg
cgcgctgcactacaaatttcggaacaaggcctttcttgtgctttgttgtctaaagtattc
ccaacccgttctcatactgtatctgctcaaggcggtatcacagttgcgcttggtaactcg
cataaggacgattggcaatggcacatgtacgacacagtaaaaggttctgattacattggt
gaccagaacgcgattgaatacatgtgtaaaaatggtcctgagtcagttatcgagctagaa
aaaatgggtcttccattctctcgttttgataacggtaccatctaccaacgtccattcggc
ggtcagtcaaaagagtttggtggtgagcaggcggcgcgcacagcagctgcagcagaccgt
acaggtcacgctcttcttcatacgctttaccaacaaaacgtcaaacataagacaaccatc
ttttctgaatggtacgctttggatcttgtgaaaaaccaagatggcgcaatcatgggttgt
actgcgatctgtatggaaacgggtgaaatctgttacttcaaatcgaaagcaacaattcta
gctactggtggtgcaggtcgtatttacgcatcgacaactaacgcgcacatcaacacgggt
gatggcgttggtatggcacttcgtgcaggtgttccaatgcaagacatggaaatgtggcag
ttccacccaacgggtattgctggcgcgggtgttcttgtgacagaaggctgtcgtggtgaa
ggtggttaccttctaaacaaagacggcgaacgctttatggaacgttacgctccaaacgcg
aaagaccttgctggtcgcgacgttgttgctcgctctatgatgattgaaatccgtgaaggc
cgcggttgtgatggcccttggggtccacatatcaagttgaaacttgatcaccttggcaaa
gaagtacttgaatcacgtctgccaggtatctgtgaactgtctcgtacattcgcacacgtt
gatccagtgaaagaaccaattccagtaattccaacttgtcactacatgatgggtggtgtt
ccgactcaagtttctggtcaagcgattaagcaacttgcggatggcagcgaagcggaagtt
caaggtctatacgcttgtggtgaaattgcttctgtatctgtacacggtgcaaaccgtcta
ggtggtaactcactactagacttggtggtatttggtcgtgcaacaggcctacacctaggt
gagactcttgctgctcaagttgaagctcgccctgcaactgaatcagacatcgaagcttct
ctagcgcgcactatgcgttgggaaaatagcactggtggcgaagatccagtacaaatccgt
aaagacctacaacgctgtatgcaaaacagtttctcggtattccgcgaaggtgatgcaatg
gcgacgggcctagaagagttgaaggtaattcgtgaacgtctgaaagatgctcatttagcc
gacaaatcttctgagttcaacacgcaacgtattgagtgtctagaactagataacctgatg
gaaaccgcgttctcaacagcagttgcagcaaactaccgtacagaaagccgtggtgctcat
gctcgcttcgacttccctgagcgtgatgatgagaactggctatgccactctatctacaac
ccggaaaccgaagcgatgactaagcgtgatgtaaacatgacgccagtacaccgtgacgcg
ttcccaccgaaagtacgtacatactaa

DBGET integrated database retrieval system