KEGG   Vibrio parahaemolyticus O1 Kuk FDA_R31: M634_06240Help
Entry
M634_06240        CDS       T02761                                 

Gene name
sdhB
Definition
(GenBank) succinate dehydrogenase iron-sulfur subunit
  KO
K00240  succinate dehydrogenase / fumarate reductase, iron-sulfur subunit [EC:1.3.5.1 1.3.5.4]
Organism
vpf  Vibrio parahaemolyticus O1:Kuk FDA_R31
Pathway
vpf00020  Citrate cycle (TCA cycle)
vpf00190  Oxidative phosphorylation
vpf00650  Butanoate metabolism
vpf01100  Metabolic pathways
vpf01110  Biosynthesis of secondary metabolites
vpf01120  Microbial metabolism in diverse environments
vpf01130  Biosynthesis of antibiotics
vpf01200  Carbon metabolism
Module
vpf_M00009  Citrate cycle (TCA cycle, Krebs cycle)
vpf_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
vpf_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:vpf00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    M634_06240 (sdhB)
   00650 Butanoate metabolism
    M634_06240 (sdhB)
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    M634_06240 (sdhB)
Enzymes [BR:vpf01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     M634_06240 (sdhB)
    1.3.5.4  fumarate reductase (quinol)
     M634_06240 (sdhB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fer2_3 Fer4_17 Fer4_8 Fer4_10 Fer4_7 Fer4_9 Fer4_4 Fer4 Fer4_6
Motif
Other DBs
NCBI-ProteinID: AGQ90401
UniProt: S5J029
LinkDB All DBs
Position
I:1274238..1274948
Genome map
AA seq 236 aa AA seqDB search
MKLNFSLYRYNPDVDTKPYMKEYTLDVDEGSDMMVLDALILLKEQDPSIAFRRSCREGVC
GSDGLNMNGKNGLACITPLSALQGDKIVIRPLPGLPVVRDLIVDMTQFYDNYAKVKPFLI
DDGALPPSRENLQSPDERAHLDGLYECIMCACCTTSCPSFWWNPDKFIGPAGLLAAYRWL
IDSRDTATDERLSDLDDAFSVFRCHGIMNCVSVCPKGLNPTKAIGHIKSMLVNRSV
NT seq 711 nt NT seq  +upstreamnt  +downstreamnt
atgaaactgaacttctctttgtaccgttacaacccggacgtagatactaagccttacatg
aaagagtacacacttgacgtagacgaaggctcagacatgatggtgcttgatgcattgatt
ctgctaaaagagcaagatccaagcatcgcattccgtcgttcttgtcgtgaaggtgtgtgt
ggttctgatggtttgaacatgaacggcaaaaatggtctggcatgtatcactccattatcg
gctctacaaggtgacaagatcgtcattcgtcctctaccgggtctacctgtagtgcgcgat
cttatcgttgacatgacgcagttctatgataactatgcgaaagttaagcctttcttaatt
gatgacggtgctctaccgccatcacgcgagaacctgcaatctccagatgagcgtgcgcat
ttagatggattgtacgaatgtatcatgtgtgcatgttgtacaacttcttgtccgtcattc
tggtggaacccagataagtttattggccctgcaggcctacttgcggcttaccgctggttg
attgatagccgagatacggcaacagatgaacgtttgtctgatcttgatgatgcatttagc
gtttttcgttgccatggcatcatgaattgtgtaagtgtttgtcctaagggactaaatccg
acgaaagccatcggtcacattaagtcgatgctggtgaatcgctcggtttaa

DBGET integrated database retrieval system