KEGG   Vibrio parahaemolyticus O1 Kuk FDA_R31: M634_08090Help
Entry
M634_08090        CDS       T02761                                 

Definition
(GenBank) glutamate decarboxylase
  KO
K01580  glutamate decarboxylase [EC:4.1.1.15]
Organism
vpf  Vibrio parahaemolyticus O1:Kuk FDA_R31
Pathway
vpf00250  Alanine, aspartate and glutamate metabolism
vpf00410  beta-Alanine metabolism
vpf00430  Taurine and hypotaurine metabolism
vpf00650  Butanoate metabolism
vpf01100  Metabolic pathways
vpf01110  Biosynthesis of secondary metabolites
vpf01120  Microbial metabolism in diverse environments
vpf02024  Quorum sensing
Module
vpf_M00027  GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:vpf00001]
 Metabolism
  Carbohydrate metabolism
   00650 Butanoate metabolism
    M634_08090
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    M634_08090
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    M634_08090
   00430 Taurine and hypotaurine metabolism
    M634_08090
 Cellular Processes
  Cellular community - prokaryotes
   02024 Quorum sensing
    M634_08090
Enzymes [BR:vpf01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.15  glutamate decarboxylase
     M634_08090
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyridoxal_deC Beta_elim_lyase Aminotran_5 SepSecS Aminotran_1_2 HSCB_C AAA_33
Motif
Other DBs
NCBI-ProteinID: AGQ90714
UniProt: S5IQ79
LinkDB All DBs
Position
I:complement(1684065..1685711)
Genome map
AA seq 548 aa AA seqDB search
MVKEQKTADVSFESLLKIFTVPEGPDSTLTKIDESLSRNLNQFLREHIVAEEKPLREIEK
DFSSAQIPEQPEFVSDHTEHLLDTLVSHSVHTSAPSFIGHMTSALPYFLMPLSKIMIALN
QNLVKIETSKAFTPLERQVLGMLHRLIYGQNDKFYRKWMHSANHSLGAFCSGGTIANITA
LWVARNKALKADGGFKGVEKEGLFKAMKYYGYEGLAVLVSERGHYSLKKAADVLGLGQEG
LVAVKTDANNRIVVDDLKAKIAELKEQNIKPIAVIGVAGTTETGNVDPLSQIAQVCQEHN
CHFHVDAAWGGATLMSNHYRHLLEGVELADSVTIDAHKQLYIPMGAGMVLFKDPDAMKSI
EHHAQYILRKGSKDLGSHTLEGSRSGMAMLVYAAMHIISRPGYELLIDQSIEKARYFADL
IKQQDDFELVSEPELCLLTYRYLPPLIREALDKAEGTQKEKLNELINQLTQFIQKRQRET
GKSFVSRTRLNPDQWQRMNTIVFRVVLANPLTTRDILSSVLDEQREIAKQAPSLTAKIEE
MASNILGA
NT seq 1647 nt NT seq  +upstreamnt  +downstreamnt
atggttaaggaacaaaaaaccgctgacgttagctttgagagcttgctaaagatcttcacc
gtacctgaaggtcctgattctacgttgacaaaaattgacgaaagtctctcccgaaactta
aaccaatttcttcgtgaacacatcgtggcagaagaaaagcctttacgtgaaatcgaaaaa
gacttttcttctgctcagattcctgagcaacctgaattcgtgtcagaccacaccgagcac
ctgctagacacgttagtgtcgcactcggttcacacttcagccccaagttttatcggtcac
atgacctcggcgctaccctacttcttgatgcctttatccaagatcatgatcgcgctaaac
caaaacttggttaagatcgaaacatcaaaagcattcacacctcttgagcgtcaagtttta
gggatgttacaccgcttaatttacggccaaaacgacaagttttatcgtaaatggatgcac
agcgcgaaccattcacttggtgcgttttgctctggtggcacaatcgcgaacattacggcg
ctttgggttgcacgcaataaagcgttgaaagcagatggtggtttcaaaggggtagaaaaa
gaaggtctattcaaagccatgaagtactatggctacgaaggccttgcagttctggtttct
gaacgtggtcactattcactgaaaaaagcagcagacgtacttggcttaggtcaagagggt
ttagtcgcggtgaaaaccgatgcaaacaaccgtattgttgttgacgacctaaaagcaaaa
attgccgagcttaaagaacaaaacatcaaaccaattgcggttatcggtgtcgctggcaca
acagaaacggggaacgtcgatcctctgtcacagatcgctcaagtgtgccaagagcacaat
tgtcacttccatgtagatgccgcttggggtggtgcaacgttgatgtctaatcattaccgt
caccttctcgaaggtgttgaactggctgactcagtgactatcgacgcgcacaaacaactg
tacatccctatgggtgcaggcatggtgttgttcaaagacccagacgcgatgaaatccatt
gaacaccatgcgcaatacatcttacgtaaaggttcaaaagatttaggtagtcatacacta
gaaggctctcgctcaggcatggccatgttagtgtatgcggcgatgcacattattagtcgc
ccaggctacgaactattgatcgaccaaagtatcgagaaagcgcgctactttgccgatctc
atcaaacagcaagatgacttcgaactcgtttctgaaccggagctttgtctactgacatac
cgctatctaccgccattgattcgtgaagcgctagataaagcggaaggtactcaaaaggaa
aaactaaacgagctcatcaaccagctcacgcagtttatccagaagcgtcaacgtgaaacg
ggcaaatcgtttgtttctcgtacaagactgaaccctgaccaatggcaaagaatgaacacc
atcgtattccgagtggtgcttgccaacccattgacgaccagagatatcttgagctcagta
ctggacgaacaacgcgaaatcgccaaacaagcaccaagtttgacagcaaaaatcgaagaa
atggcctcaaatattttaggcgcgtaa

DBGET integrated database retrieval system