KEGG   Vibrio parahaemolyticus O1 Kuk FDA_R31: M634_09955Help
Entry
M634_09955        CDS       T02761                                 

Definition
(GenBank) DNA ligase
  KO
K10747  DNA ligase 1 [EC:6.5.1.1 6.5.1.6 6.5.1.7]
Organism
vpf  Vibrio parahaemolyticus O1:Kuk FDA_R31
Pathway
vpf03030  DNA replication
vpf03410  Base excision repair
vpf03420  Nucleotide excision repair
vpf03430  Mismatch repair
Brite
KEGG Orthology (KO) [BR:vpf00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    M634_09955
   03410 Base excision repair
    M634_09955
   03420 Nucleotide excision repair
    M634_09955
   03430 Mismatch repair
    M634_09955
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:vpf03032]
    M634_09955
   03400 DNA repair and recombination proteins [BR:vpf03400]
    M634_09955
Enzymes [BR:vpf01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     M634_09955
    6.5.1.6  DNA ligase (ATP or NAD+)
     M634_09955
    6.5.1.7  DNA ligase (ATP, ADP or GTP)
     M634_09955
DNA replication proteins [BR:vpf03032]
 Eukaryotic Type
  DNA Replication Elongation Factors
   Other elongation factors
    M634_09955
 Prokaryotic Type
   Elongation factors (archaeal)
    Other elongation factors
     M634_09955
DNA repair and recombination proteins [BR:vpf03400]
 Eukaryotic Type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    Long Patch-BER factors
     M634_09955
   NER (nucleotide excision repair)
    Other NER factors
     M634_09955
   MMR (mismatch exicision repair)
    Other MMR factors
     M634_09955
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DNA_ligase_OB_2 DNA_ligase_A_M RNA_ligase ParA
Motif
Other DBs
NCBI-ProteinID: AGQ91011
UniProt: S5J1Q6
LinkDB All DBs
Position
I:complement(2100023..2100865)
Genome map
AA seq 280 aa AA seqDB search
MPLKMTLIALAVMASAQPQANTPIAPPVSLAETYQDGIDVSEYWYSEKLDGIRAYWTGQH
LVTRNGNRIYAPEWFTESLPNYPLDGELWAGRGNFHIVQQTVLDKTPIDSAWREIDFMVF
DMPYSAGDYRKRYYNIQDLVFDIDEHHIKYVEHRAIQNEQHLFAQLDKISLSDGEGVMLR
KVSSRYQAGRGSDLLKLKRYADTEAQVVGYKPGTGRLLGMMGALLVRLPDGTEFYIGSGF
TDEVRRHPPKIGSTITFRYNGFTQTGKPRFARFLRERLKE
NT seq 843 nt NT seq  +upstreamnt  +downstreamnt
atgccattaaaaatgacattgattgcccttgccgttatggcatctgcgcagccacaagcg
aatacacctatagctccgcccgtctctcttgctgaaacctatcaagatggaatagatgtt
tctgagtattggtacagtgagaaactcgatggaattcgagcctactggacaggtcaacac
ctcgtgacccgaaacggaaaccgaatttatgcgcccgagtggttcactgagtcactcccg
aactatccattggatggtgagctttgggccggacgcggaaattttcacattgttcagcaa
accgttcttgataaaacaccaattgatagcgcgtggcgcgaaatcgattttatggtgttt
gacatgccgtattccgctggagattaccgaaaacgttattacaacattcaggatttagtg
tttgatattgatgagcaccacatcaaatacgttgagcaccgagccatccaaaacgagcaa
catttgttcgctcaactggataaaatttccttgtccgatggcgaaggcgtgatgctgcgt
aaagtgtcgagccgttaccaagcgggcagaggaagcgacttacttaagctaaagcgctac
gccgacacggaagctcaagtggttggctacaaaccgggaacggggcgtttgcttgggatg
atgggcgcattgcttgtgcgtttgccagatggtacagagttttacatcggcagcggtttt
acggatgaagttcgtcgccatccgccaaaaatcggctctaccattacgtttagatataac
ggatttacccaaacggggaaaccaagatttgctcgctttttgagagaacgactcaaagag
tag

DBGET integrated database retrieval system