KEGG   Vibrio parahaemolyticus O1 Kuk FDA_R31: M634_12845Help
Entry
M634_12845        CDS       T02761                                 

Definition
(GenBank) superoxide dismutase
  KO
K04564  superoxide dismutase, Fe-Mn family [EC:1.15.1.1]
Organism
vpf  Vibrio parahaemolyticus O1:Kuk FDA_R31
Brite
Enzymes [BR:vpf01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     M634_12845
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sod_Fe_C Sod_Fe_N
Motif
Other DBs
NCBI-ProteinID: AGQ91310
UniProt: S5ITJ5
LinkDB All DBs
Position
I:2669168..2669752
Genome map
AA seq 194 aa AA seqDB search
MAFELPALPYAKDALEPHISAETLDYHHGKHHNTYVVKLNGLIPGTEFEGKTLEEIIKTS
TGGVFNNAAQIWNHTFYWHCLAPNAGDEPTGAVADAINAAFGSFEEFKAKFTDAAINNFG
SSWTWLVKKADGSLEIVNTSNAATPLTEEGTTPLLTVDLWEHAYYIDYRNVRPDYMNGFW
ALVNWDFVAENLAK
NT seq 585 nt NT seq  +upstreamnt  +downstreamnt
atggcatttgaactaccagctcttccttacgcgaaagacgcactagaaccacacatctca
gcagagactctagactaccaccacggtaagcaccacaacacttacgttgttaagcttaac
ggtcttatccctggtactgagttcgaaggcaaaactctagaagagatcatcaagacttct
actggtggcgtattcaacaacgcagcgcaaatctggaaccacacgttctactggcactgt
cttgctccaaacgcgggcgacgaaccaactggcgcagttgcagacgcaatcaacgcagca
ttcggttctttcgaagaattcaaagcgaagttcactgacgcagcaatcaacaacttcggt
tcttcatggacttggctagttaagaaagctgacggttctctagaaatcgttaacacttct
aatgcagcaacgccactaacagaagaaggtactactccacttctaactgttgacctatgg
gaacacgcgtactacatcgattaccgcaacgtacgtcctgattacatgaacggcttctgg
gctcttgtaaactgggatttcgtagctgagaacctagcgaagtaa

DBGET integrated database retrieval system