KEGG   Vibrio parahaemolyticus O1 Kuk FDA_R31: M634_13370Help
Entry
M634_13370        CDS       T02761                                 

Definition
(GenBank) 3-oxoacyl-ACP synthase
  KO
K00647  3-oxoacyl-[acyl-carrier-protein] synthase I [EC:2.3.1.41]
Organism
vpf  Vibrio parahaemolyticus O1:Kuk FDA_R31
Pathway
vpf00061  Fatty acid biosynthesis
vpf00780  Biotin metabolism
vpf01100  Metabolic pathways
vpf01212  Fatty acid metabolism
Module
vpf_M00083  Fatty acid biosynthesis, elongation
Brite
KEGG Orthology (KO) [BR:vpf00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    M634_13370
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    M634_13370
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:vpf01004]
    M634_13370
Enzymes [BR:vpf01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.41  beta-ketoacyl-[acyl-carrier-protein] synthase I
     M634_13370
Lipid biosynthesis proteins [BR:vpf01004]
 Fatty acid synthase
  Component type
   M634_13370
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ketoacyl-synt Ketoacyl-synt_C KAsynt_C_assoc Thiolase_N CaMKII_AD
Motif
Other DBs
NCBI-ProteinID: AGQ91388
UniProt: S5J750
LinkDB All DBs
Position
I:complement(2770600..2771811)
Genome map
AA seq 403 aa AA seqDB search
MKRVVITGMGIVSSIGNNVEEVLASLKAGKSGITASEQFKEHGLRSQVWGDLKINPAEHI
DRKQMRFMGDAAAYAYLSMQQAIEDAGLTEEQVSNDRTGIVAGSGGASALNQTVATDIMR
EKGVKRVGPYMVPRTMSSTVSACLATPFKIRGVNYSMSSACATSAHCIGHAMELIQLGKQ
DIVFAGGGEELDWSQTMMFDAMGALSTKYNDTPEKASRTYDADRDGFVISGGGGMLVIEE
LEHALARGAKIYGEIVGYGATSDGYDMVAPSGEGAVRCMKMAMQDVDSIDYVNTHGTSTP
VGDVKELGAIQELFGDNSPAISATKAMTGHALGAAGVHEAIYSTLMLDNNFIAPSINIEN
LDEAAKGLDIVTEARDAELTTVMSNSFGFGGTNATLVIKKYQA
NT seq 1212 nt NT seq  +upstreamnt  +downstreamnt
atgaaacgagtcgtaatcaccggtatgggtattgtttcaagtatcggtaacaacgtcgaa
gaagttctagcgtctcttaaagcgggcaaatctggcatcactgcgtctgagcagttcaaa
gaacacggtcttcgttcgcaagtttggggtgatctaaagatcaaccctgcggagcatatt
gaccgtaaacagatgcgctttatgggtgatgcggctgcttatgcatacctatcaatgcag
caggcgattgaagacgctggtctaactgaagaacaagtttcaaacgatcgtacaggtatc
gttgctggttctggtggtgcttctgcattaaaccaaacagtagcaaccgatattatgcgc
gagaaaggcgtaaaacgcgtaggtccttacatggttcctcgtactatgtcttctaccgta
tcagcatgtcttgcgacaccatttaaaattcgtggtgtgaactactcaatgagttcagct
tgtgcgacatctgcacactgtatcggccacgcaatggagcttatccaacttggcaaacaa
gacatcgtgtttgcaggtggtggtgaagagctagattggtctcaaacgatgatgtttgat
gcgatgggcgcactatcaactaaatacaacgatacgccagaaaaagcgtctcgtacttac
gatgcagaccgtgacggttttgttatctctggcggcggcggcatgctggttatcgaagaa
cttgagcacgctctagcacgtggcgcgaaaatctacggcgaaatcgtaggctacggtgcg
acttctgatggctacgacatggtagcaccttcaggtgaaggcgcagtgcgttgtatgaag
atggcaatgcaagacgttgacagcattgattacgttaacactcacggtacgtctactcca
gttggcgacgtgaaagagctaggcgcaatccaagagctatttggcgacaacagcccagca
atctctgcaacaaaagcgatgacaggtcacgctctaggtgcggctggtgttcacgaagcg
atttactcgactctaatgctagacaacaacttcatcgcgccaagcatcaatattgaaaac
ttggatgaagcggcaaaaggtctggatatcgtgacagaagctcgcgacgcagagctaacg
acagtcatgtcaaacagctttggcttcggtggtaccaacgcaacattggttatcaaaaaa
taccaagcgtaa

DBGET integrated database retrieval system