KEGG   Vibrio parahaemolyticus O1 Kuk FDA_R31: M634_17880Help
Entry
M634_17880        CDS       T02761                                 

Definition
(GenBank) NADH dehydrogenase
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
vpf  Vibrio parahaemolyticus O1:Kuk FDA_R31
Brite
KEGG Orthology (KO) [BR:vpf00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    M634_17880
Enzymes [BR:vpf01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     M634_17880
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox Thioredoxin_3 GIDA FAD_oxidored FAD_binding_2 Glutaredoxin HI0933_like Thioredoxin_9 FAD_binding_3 DAO Thi4 Chalcone_N NAD_binding_8 Thioredoxin_4 DUF5474
Motif
Other DBs
NCBI-ProteinID: AGQ92776
UniProt: S5J6W6
LinkDB All DBs
Position
II:382247..383815
Genome map
AA seq 522 aa AA seqDB search
MLDQAIQQQLKQYLANVKEDVRLVVSLDESKASNDILSLANQIAEMSDFITVERDDNASA
RKPVMTVTNPVKGTALRFAGLPMGHEFTSLVLALLHSGGHPIKLEPEVIEQIAALDKELE
VEVFISLSCQNCPDVVQAFNMMAAINPKVKATMIDGALFQDEVKQRDIMAVPSVFVNGEL
FGQGRMSLTEILNKVDDGASEKAAKALSEKDPYDVLVVGGGPGGSAAALYAARKGIRTGV
VAKRFGGQVMDTMAIENFISVKRTEGPKLATDLAEHLKEYDVDVVTEQQAQKLMGAAHTE
DGLIHIQLESGATLKSKSVILSPGARWREMNVPGEQEYRNKGVAYCPHCDGPLFKGKKTA
VIGGGNSGIEAAIDLAGIVEHVTVLEFADVLRADQVLIDKANSLPNIDIITMAQTTEVVG
DGTRVTSLKYKDRNTDEIKEIELSGIFVQIGLVPNTEWLKDSEVALSERGEIEVGSRGET
SLEGVFAAGDATTVPYKQIIIAMGEGAKASLGAFDYLIRKQG
NT seq 1569 nt NT seq  +upstreamnt  +downstreamnt
atgttagaccaagcgatccaacaacaactcaaacaatatctggctaatgtaaaagaagac
gttcgtctagtggttagtctagatgaaagcaaagcatcgaatgacattctgtctctggcg
aaccaaatcgcagagatgagcgactttatcaccgttgaacgtgacgacaacgcaagcgca
cgtaaaccagtgatgacggtgaccaatcctgtaaaaggcacagcacttcgctttgctggc
ctaccaatgggtcacgaatttacctctctggtattggcattgctgcactctggtggtcac
ccaatcaaactagagccggaagtgattgaacaaatcgcagcgctagataaagagttggaa
gttgaagtgttcatttcactgtcgtgccaaaactgtccagacgttgtacaagcgttcaac
atgatggcggcgatcaacccgaaagtgaaagcaaccatgatcgacggtgcactattccaa
gatgaagtgaaacaacgcgacatcatggccgtaccaagcgtattcgtaaacggagagcta
ttcggtcaaggtcgtatgtctctgactgaaatcctaaacaaagtggatgacggtgcgagc
gagaaagcagccaaagcactgagcgaaaaagacccatacgacgtactagttgtcggcggt
ggccctggtggtagtgcagcagcactatacgcagcgcgtaaaggtattcgcactggcgtt
gtcgctaaacgcttcggtggtcaggtgatggacaccatggcaatcgagaactttatctcg
gtaaaacgtactgaaggtccaaaactggcgactgacctagcagagcacctaaaagaatac
gacgtagacgtcgtgactgagcaacaagcgcaaaaactgatgggcgcagcacatacagaa
gatggcttgattcatatccaacttgaaagcggcgcaacgctgaaaagtaagagtgtcatc
ctaagccctggtgctcgctggcgtgaaatgaacgttccgggtgagcaagagtaccgcaac
aaaggcgtcgcgtactgcccacactgtgacggccctctgttcaaaggcaagaaaactgcg
gttatcggtggtggtaactcaggcatcgaagccgctatcgaccttgctggtatcgtagaa
cacgtaacggttcttgaattcgcagacgtacttcgcgcagaccaagtgcttatcgacaaa
gcgaactctctaccaaacatcgacatcatcacgatggcgcaaaccacagaagtagtgggt
gacggtactcgcgtaacaagcttgaagtacaaagaccgtaacacagatgaaatcaaagag
attgaactgtcaggtatctttgtccaaatcggtctagtaccaaacacagaatggctaaaa
gattcagaagtagcgctttctgagcgcggcgaaattgaagttggtagccgtggtgaaacc
agcctggaaggtgtcttcgcagcgggtgacgcaacgacggttccttacaaacagatcatc
attgcgatgggtgaaggtgcaaaagcaagcttaggcgcgtttgactacctaatccgtaag
caaggttaa

DBGET integrated database retrieval system