KEGG   Vibrio parahaemolyticus O1 Kuk FDA_R31: M634_22405Help
Entry
M634_22405        CDS       T02761                                 

Definition
(GenBank) D-alanine--D-alanine ligase
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
vpf  Vibrio parahaemolyticus O1:Kuk FDA_R31
Pathway
vpf00473  D-Alanine metabolism
vpf00550  Peptidoglycan biosynthesis
vpf01100  Metabolic pathways
vpf01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:vpf00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    M634_22405
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    M634_22405
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01502 Vancomycin resistance
    M634_22405
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:vpf01011]
    M634_22405
Enzymes [BR:vpf01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     M634_22405
Peptidoglycan biosynthesis and degradation proteins [BR:vpf01011]
 Precursor biosynthesis
  Amino acid ligase
   M634_22405
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N ATP-grasp CPSase_L_D2 ATPgrasp_ST Peptidase_M55
Motif
Other DBs
NCBI-ProteinID: AGQ93510
UniProt: S5IZR9
LinkDB All DBs
Position
II:1366588..1367577
Genome map
AA seq 329 aa AA seqDB search
MIKNILLLCGGGSSEHEISLLSANFVEQQLNLIQNVKVTRVEIKNEGWVTDQGELVYLDL
NTKQLCSNESNQTIDFIVPCIHGFPGETGDIQSLFEIAGIPYLGCGPEASSNSFNKITSK
LWYDALDIPNTPYLFLTRNDEHAHRQAEQAFEKWGKVFVKAARQGSSVGCYSVTEKQAIA
KAVNDAFGYSDQVLVEKAVKPRELEVAAYEMNGELHITKPGEVIAPDGAFYSYDEKYSSS
SHSLTEVEAKNLTQEQIDRIHHASETVFKQMNLRHLSRIDFFLTEDNEIYLNEVNTFPGM
TPISMFPKMLQNNGHKFHEFLEDCINSAK
NT seq 990 nt NT seq  +upstreamnt  +downstreamnt
atgattaaaaatattcttctattatgcggcggcggctcttctgaacacgaaatttcactg
ttgtcggctaactttgttgaacaacaactaaacctaattcagaacgtcaaagtcactcgc
gtagaaataaaaaatgaaggttgggtcacagatcaaggcgaattggtttaccttgattta
aacaccaaacaattgtgctcgaatgaatccaatcaaacgatcgactttattgtgccttgt
attcacggctttcctggcgagactggtgacattcaatcactattcgaaattgccggtatt
ccatacttaggatgtggaccagaagcaagcagcaacagtttcaataaaatcacatcaaaa
ctttggtacgacgctttagacattccaaatacaccttacttattcctaactcgcaatgat
gagcacgctcacagacaagctgaacaagcctttgaaaagtgggggaaagtgtttgttaaa
gctgcacgacaaggttcatctgttgggtgttacagtgtaactgaaaagcaagctatcgct
aaagcagtaaacgatgcgtttggttattcagatcaagtacttgtagagaaagcggtaaaa
cctcgtgagttagaagtcgcagcttatgaaatgaacggtgaactgcacatcactaagcca
ggtgaggtgatcgcacccgatggtgcattttactcatacgatgaaaaatacagcagctca
agccattcattaacagaagtagaagcgaagaacctgactcaagaacagatcgataggatt
catcatgcgtcagaaaccgtattcaaacaaatgaaccttcgtcatttgtctcgcatcgac
tttttccttacggaagataacgaaatttacttgaatgaagtgaatacattcccaggaatg
acgccaatttcaatgttccctaaaatgcttcaaaacaatggtcacaagttccatgagttt
cttgaagattgtattaatagtgcaaagtga

DBGET integrated database retrieval system