KEGG   Vibrio parahaemolyticus UCM-V493: VPUCM_0452Help
Entry
VPUCM_0452        CDS       T03116                                 

Definition
(GenBank) UDP-N-acetylmuramate--alanine ligase
  KO
K01924  UDP-N-acetylmuramate--alanine ligase [EC:6.3.2.8]
Organism
vph  Vibrio parahaemolyticus UCM-V493
Pathway
vph00471  D-Glutamine and D-glutamate metabolism
vph00550  Peptidoglycan biosynthesis
vph01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:vph00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00471 D-Glutamine and D-glutamate metabolism
    VPUCM_0452
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    VPUCM_0452
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:vph01011]
    VPUCM_0452
Enzymes [BR:vph01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.8  UDP-N-acetylmuramate---L-alanine ligase
     VPUCM_0452
Peptidoglycan biosynthesis and degradation proteins [BR:vph01011]
 Precursor biosynthesis
  Amino acid ligase
   VPUCM_0452
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Mur_ligase_M Mur_ligase Mur_ligase_C BRCT
Motif
Other DBs
NCBI-ProteinID: AHI98410
LinkDB All DBs
Position
1:476941..478398
Genome map
AA seq 485 aa AA seqDB search
MTIQHTQDLAQIRAMVPEMRRVKCIHFIGIGGAGMSGIAEVLLNEGYEITGSDLSENPVT
ERLVSKGATVFIGHQASNVEKASVVVVSTAINEENPEVMAARELRIPIVRRAEMLAELMR
FRHGIAVAGTHGKTTTTALVTQIYSEAGLDPTFVNGGLVKSAGTNARLGSSRILIAEADE
SDASFLHLQPMVSIVTNIEADHMDTYGGDFETLKQTFIDFLHNLPFYGQAIVCIDDPVIR
ELIPRISRQVITYGFSDDADVRIENYHQEGQQGKFTVVRKGLANLDITLNIPGRHNALNA
SAAIAVATEDDIEDEAILKAMAGTQGTGRRFDHLGEFDTGNGHAMLVDDYGHHPTEVDVT
INAARSGWQDKRLVMIFQPHRYSRTRDLYDDFANVLEQVDVLIMLDVYAAGEKPIAGADG
RSLCRTIRSRGKVDPIFVPEIEQLPSVLANVIQDGDLILTQGAGDVGKVAKQLANLELNI
NKMLG
NT seq 1458 nt NT seq  +upstreamnt  +downstreamnt
atgactatccaacatacacaagacttagctcagattcgcgcgatggtaccagaaatgcgt
cgcgtgaaatgcatccacttcatcggtatcggtggtgcgggcatgagcggcattgctgaa
gttcttctaaacgaaggttatgaaatcacgggttcagacttgtctgaaaacccagtaacc
gagcgcttagtgtcaaaaggggcaaccgtatttattggtcaccaagcaagtaatgtcgaa
aaggctagtgtggtagtcgtttccacagcgattaacgaagaaaaccctgaagtcatggcg
gctcgtgaattgcgtattcctattgttcgccgagcagaaatgctggctgaactgatgcga
ttccgtcatggtatcgctgttgcgggtacacatggtaaaaccaccaccacagcactagtc
acacaaatctattccgaagcaggccttgatccaacgtttgtaaacggcggtctagtaaag
agcgcgggcacaaatgcgcgcttgggctctagccgtattctgattgcagaagcggatgag
agcgacgcctctttcttgcacctgcaacctatggtgagcatcgttaccaacatcgaagct
gaccacatggatacctacggtggtgacttcgaaacgttgaaacaaaccttcattgatttt
cttcacaacctgccgttttatggccaagccattgtctgtatcgatgatccagtgattcgc
gagttgattccgcgtattagccgtcaagtgatcacctacggcttttctgacgatgcggac
gtgcgtatcgaaaattatcatcaagaaggtcagcaaggtaaatttacagtagtacgtaaa
ggcctagctaacctcgatatcacgctaaacattcctggccgtcacaatgcgttgaacgca
tcagcagcaatagcggttgcaacggaagatgacattgaagatgaagcgattctaaaagcg
atggcgggcactcaaggtactggccgtcgttttgatcaccttggtgagtttgatacaggt
aacggtcatgcgatgttagtcgatgattacggtcatcacccaacggaagttgacgtcacc
attaatgcagcacgcagcggttggcaagataagcgattggttatgattttccaaccacat
cgttacagtcgcactcgtgacctttacgatgattttgcaaacgtgcttgagcaggttgat
gtattgatcatgcttgacgtgtatgccgcgggtgaaaaaccgattgccggcgcggatgga
cgctctttgtgccgtacgattcgcagccgaggtaaagtagatccgatttttgttccagaa
atcgagcaattaccatcagttttggctaacgttatacaagacggcgacctaattttaacg
caaggtgctggtgatgttggtaaagttgccaaacagctggctaatcttgagttaaatata
aacaagatgcttggataa

DBGET integrated database retrieval system