KEGG   Vibrio parahaemolyticus UCM-V493: VPUCM_1028Help
Entry
VPUCM_1028        CDS       T03116                                 

Definition
(GenBank) Aspartate aminotransferase
  KO
K14260  alanine-synthesizing transaminase [EC:2.6.1.66 2.6.1.2]
Organism
vph  Vibrio parahaemolyticus UCM-V493
Pathway
vph00220  Arginine biosynthesis
vph00250  Alanine, aspartate and glutamate metabolism
vph00290  Valine, leucine and isoleucine biosynthesis
vph01100  Metabolic pathways
vph01110  Biosynthesis of secondary metabolites
vph01130  Biosynthesis of antibiotics
vph01210  2-Oxocarboxylic acid metabolism
vph01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:vph00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    VPUCM_1028
   00290 Valine, leucine and isoleucine biosynthesis
    VPUCM_1028
   00220 Arginine biosynthesis
    VPUCM_1028
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:vph01007]
    VPUCM_1028
Enzymes [BR:vph01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.2  alanine transaminase
     VPUCM_1028
    2.6.1.66  valine---pyruvate transaminase
     VPUCM_1028
Amino acid related enzymes [BR:vph01007]
 Aminotransferase (transaminase)
  Class I
   VPUCM_1028
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_1_2 DegT_DnrJ_EryC1 Aminotran_5 Beta_elim_lyase
Motif
Other DBs
NCBI-ProteinID: AHI98986
LinkDB All DBs
Position
1:complement(1120452..1121666)
Genome map
AA seq 404 aa AA seqDB search
MQNIGMSSKLDNVCYDIRGPVLKHAKRMEEEGHKILKLNIGNPAPFGFDAPDEILVDVIR
NLPTSQGYCDSKGIYSARKAVVQHYQRKGIRSLDVEDVYVGNGVSELIVMAMQALLNNGD
EMLIPAPDYPLWTASVALSGGNPVHYLCDEQSDWYPDLDDIKKKITPKTRGIVLINPNNP
TGAVYSRDFLLEVIEIARQHKLIIFADEIYDKVLYDGATHTSVATLTEDVLVMTFNGLSK
AYRVCGFRGGWMFLTGPKHLAQGYVNGLELLSSMRLCANVPMQHAIQTALGGYQSINELI
LPGGRLLEQRNRAFELINQIPGVSCVKPKGAMYLFPKIDTKMYNIKNDQQMVLDFLKQEK
VLLVQGSGFNWPKPDHFRIVTLPHVEDLETAIGRFERFLSTYSQ
NT seq 1215 nt NT seq  +upstreamnt  +downstreamnt
atgcaaaatatcgggatgtcgtcaaaactcgacaatgtctgctacgacattaggggtcct
gtactcaaacatgctaagcgcatggaggaagaagggcataaaatcctaaagttgaacatt
ggtaaccctgccccatttggttttgacgcccctgatgagattcttgtagatgtaattcgt
aatctaccgacctctcaaggctactgtgattccaaaggcatttactctgcgcgtaaagcg
gtggttcaacattaccaacgcaaaggcattcgttctttagacgtagaagatgtgtacgtc
ggcaatggcgtgtctgagctgatcgtgatggcaatgcaagcgttgctaaacaacggcgat
gaaatgctcatccctgcgcctgactacccattgtggacggcatcagtagcgttgtctggt
ggcaaccccgttcattatctgtgtgatgaacaatcggattggtatccagaccttgatgac
atcaaaaagaaaatcacgccgaagacccgcggtattgttctgatcaacccgaacaatcca
acaggtgctgtatatagtcgtgacttcttgcttgaagtgattgagattgctcgccagcac
aagctgatcattttcgctgacgagatttacgacaaagtgctttacgatggcgcaacacac
acttctgttgcgacgctaacggaagacgtacttgtgatgaccttcaacgggttgtcgaaa
gcttaccgtgtatgtggtttccgcggtgggtggatgttcttaactggtccaaaacactta
gcacaaggctacgttaacggtctagagttgctctcttctatgcgtctttgtgccaacgtg
ccgatgcaacatgcgattcaaaccgcgctaggtggctaccaaagtatcaatgagttgatc
ttacctggtggccgattgctagagcagcgtaatcgcgcgttcgagctgatcaaccagatc
ccaggggtatcttgtgtgaaacccaaaggtgccatgtacttattccctaaaatcgatacc
aagatgtacaacatcaagaatgaccaacagatggtgctcgatttcttgaaacaggaaaaa
gtactgctagtacaaggctcaggttttaactggccaaaaccagaccatttccgcattgtg
actttgccacacgttgaagatctggaaaccgcaatcggacgcttcgagcgattcctatca
acctacagccagtaa

DBGET integrated database retrieval system