KEGG   Vibrio parahaemolyticus UCM-V493: VPUCM_1981Help
Entry
VPUCM_1981        CDS       T03116                                 

Definition
(GenBank) Glutamate decarboxylase, eukaryotic type
  KO
K01580  glutamate decarboxylase [EC:4.1.1.15]
Organism
vph  Vibrio parahaemolyticus UCM-V493
Pathway
vph00250  Alanine, aspartate and glutamate metabolism
vph00410  beta-Alanine metabolism
vph00430  Taurine and hypotaurine metabolism
vph00650  Butanoate metabolism
vph01100  Metabolic pathways
vph01110  Biosynthesis of secondary metabolites
vph01120  Microbial metabolism in diverse environments
vph02024  Quorum sensing
Module
vph_M00027  GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:vph00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    VPUCM_1981
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    VPUCM_1981
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    VPUCM_1981
   00430 Taurine and hypotaurine metabolism
    VPUCM_1981
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    VPUCM_1981
Enzymes [BR:vph01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.15  glutamate decarboxylase
     VPUCM_1981
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyridoxal_deC Beta_elim_lyase Aminotran_5 SepSecS Aminotran_1_2 HSCB_C AAA_33
Motif
Other DBs
NCBI-ProteinID: AHI99939
LinkDB All DBs
Position
1:2126417..2128063
Genome map
AA seq 548 aa AA seqDB search
MVKEQKTADVSFESLLKIFTVPEGPDSTLTKIDESLSRNLNQFLREHIVAEEKPLREIEK
DFSSAQIPEQPEFVSDHTEHLLDTLVSHSVHTSAPSFIGHMTSALPYFLMPLSKIMIALN
QNLVKIETSKAFTPLERQVLGMLHRLIYGQNDKFYRKWMHSANHSLGAFCSGGTIANITA
LWVARNKALKADGDFKGVEKEGLFKAMKYYGYEGLAVLVSERGHYSLKKAADVLGLGQEG
LVAVKTDANNRIVVDDLKAKIAELKEQNIKPIAVIGVAGTTETGNVDPLSQIAQVCQEHN
CHFHVDAAWGGATLMSNHYRHLLEGVELADSVTIDAHKQLYIPMGAGMVLFKDPDAMKSI
EHHAQYILRKGSKDLGSHTLEGSRSGMAMLVYAAMHIISRPGYELLIDQSIEKARYFADL
IKQQDDFELVSEPELCLLTYRYLPPLIREALDKAEGTQKEKLNELINQLTQFIQKRQRET
GKSFVSRTRLNPDQWQRMNTIVFRVVLANPLTTRDILSSVLDEQREIAKQAPSLTAKIEE
MASDILGA
NT seq 1647 nt NT seq  +upstreamnt  +downstreamnt
atggttaaggaacaaaaaaccgctgacgttagctttgagagcttgctaaagatcttcacc
gtacctgaaggtcctgattctacgttgacaaaaattgacgaaagtctctcccgaaacttg
aaccaatttcttcgtgaacacatcgtggcagaagaaaagcctttacgtgaaatcgagaaa
gacttttcttctgctcagattcctgagcaacctgaattcgtgtcagatcacaccgagcac
ctgctagacacgttagtgtcgcactcggttcacacttcagccccaagttttatcggtcac
atgacctcggcgctaccctacttcttgatgcctttatccaagatcatgatcgcgctaaac
caaaacttggttaagatcgaaacatcaaaagcattcacacctcttgaacgtcaagtttta
gggatgttacaccgcttaatttacggtcaaaacgacaagttttatcgtaaatggatgcac
agcgcgaaccattcacttggtgcgttttgctctggtggcacaatcgcgaacattacggcg
ctttgggttgcacgcaataaagcgttgaaagcagatggtgatttcaaaggggtagaaaaa
gaaggtctattcaaagccatgaagtactatggctacgaaggccttgcagttctggtttct
gaacgtggtcactattcactgaaaaaagcagcagacgtacttggcttaggtcaagagggt
ttagtcgcggtgaaaaccgatgcaaacaaccgtattgttgttgacgacctaaaagcaaaa
attgccgagcttaaagaacaaaacatcaaaccaattgcggttatcggtgtagctggcacg
acagaaacggggaacgtcgatcctctgtcgcagatcgctcaagtgtgccaagagcacaat
tgtcacttccatgtagatgccgcttggggtggtgcaacgttgatgtctaatcattaccgt
caccttctcgaaggtgttgaactggctgactcagtgactatcgacgcgcacaaacaactg
tacatccctatgggtgcaggcatggtgttgttcaaagacccagacgcgatgaaatccatt
gaacaccatgcgcaatatatcttacgtaaaggttcaaaagatttaggtagtcatacacta
gaaggctctcgctcaggcatggccatgttagtgtatgcggcgatgcacattattagtcgc
ccaggctacgaactattgatcgaccaaagtatcgagaaagcgcgctactttgccgatctc
atcaaacagcaagatgacttcgaactcgtttctgaaccggagctttgtctactgacatac
cgctatctaccgccattgattcgtgaagcgctagataaagcggaaggtactcaaaaggaa
aaactaaacgagctcatcaaccagctcacgcagtttatccagaagcgtcaacgtgaaacg
ggcaaatcgtttgtttctcgtacaaggctgaaccctgaccaatggcaaagaatgaacacc
atcgtattccgagtggtgcttgccaacccattgacgaccagagatatcttgagctcagta
ctggacgaacaacgcgaaatcgccaaacaagcaccaagtttgaccgcaaaaatcgaagaa
atggcctcagatattttaggcgcgtaa

DBGET integrated database retrieval system