KEGG   Vibrio parahaemolyticus UCM-V493: VPUCM_2379Help
Entry
VPUCM_2379        CDS       T03116                                 

Definition
(GenBank) Succinate dehydrogenase flavoprotein subunit
  KO
K00239  succinate dehydrogenase / fumarate reductase, flavoprotein subunit [EC:1.3.5.1 1.3.5.4]
Organism
vph  Vibrio parahaemolyticus UCM-V493
Pathway
vph00020  Citrate cycle (TCA cycle)
vph00190  Oxidative phosphorylation
vph00650  Butanoate metabolism
vph01100  Metabolic pathways
vph01110  Biosynthesis of secondary metabolites
vph01120  Microbial metabolism in diverse environments
vph01130  Biosynthesis of antibiotics
vph01200  Carbon metabolism
Module
vph_M00009  Citrate cycle (TCA cycle, Krebs cycle)
vph_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
vph_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:vph00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    VPUCM_2379
   00650 Butanoate metabolism
    VPUCM_2379
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    VPUCM_2379
Enzymes [BR:vph01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     VPUCM_2379
    1.3.5.4  fumarate reductase (quinol)
     VPUCM_2379
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FAD_binding_2 Succ_DH_flav_C GIDA Pyr_redox_2 Thi4 HI0933_like FAD_binding_3 DAO BEX
Motif
Other DBs
NCBI-ProteinID: AHJ00338
LinkDB All DBs
Position
1:complement(2558681..2560447)
Genome map
AA seq 588 aa AA seqDB search
MSIPVREFDAVVIGAGGAGMRAALQISEQGLSCALLSKVFPTRSHTVSAQGGITVALGNS
HKDDWQWHMYDTVKGSDYIGDQNAIEYMCKNGPESVIELEKMGLPFSRFDNGTIYQRPFG
GQSKEFGGEQAARTAAAADRTGHALLHTLYQQNVKHKTTIFSEWYALDLVKNQDGAIMGC
TAICMETGEICYFKSKATILATGGAGRIYASTTNAHINTGDGVGMALRAGVPMQDMEMWQ
FHPTGIAGAGVLVTEGCRGEGGYLLNKDGERFMERYAPNAKDLAGRDVVARSMMIEIREG
RGCDGPWGPHIKLKLDHLGKEVLESRLPGICELSRTFAHVDPVKEPIPVIPTCHYMMGGV
PTQVSGQAIKQLADGSEAEVQGLYACGEIASVSVHGANRLGGNSLLDLVVFGRATGLHLG
ETLAAQVEARPATESDIEASLARTMRWENSTGGEDPVQIRKDLQRCMQNSFSVFREGDAM
ATGLEELKVIRERLKDAHLADKSSEFNTQRIECLELDNLMETAFSTAVAANYRTESRGAH
ARFDFPERDDENWLCHSIYNPETEAMTKRDVNMTPVHRDAFPPKVRTY
NT seq 1767 nt NT seq  +upstreamnt  +downstreamnt
gtgtctattccagttcgtgagtttgatgccgtagtaatcggcgctggtggtgcaggtatg
cgcgctgcactacaaatttcggaacaaggcctttcttgtgctttgttgtctaaagtattc
ccaacccgttctcatactgtatctgctcaaggcggtatcacagttgcgcttggtaactcg
cataaggacgattggcaatggcacatgtacgacacagtaaaaggttctgattacattggt
gaccagaacgcgattgaatacatgtgtaaaaatggtcctgagtcagttatcgagctagaa
aaaatgggtcttccattctctcgttttgataacggtaccatctaccaacgtccattcggc
ggtcagtcaaaagagtttggtggtgagcaggcggcgcgcacagcagctgcagcagaccgt
acaggtcacgctcttcttcatacgctttaccaacaaaacgtcaaacataagacaaccatc
ttttctgaatggtacgctttggatcttgtgaaaaaccaagatggcgcaatcatgggttgt
actgcgatctgtatggaaacgggtgaaatctgttacttcaaatcgaaagcaacaattcta
gctactggtggtgcaggtcgtatttacgcatcgacaactaacgcgcacatcaacacgggt
gatggcgttggtatggcacttcgtgcaggcgttccaatgcaagacatggaaatgtggcag
ttccacccaacgggtattgctggcgcgggtgttcttgtgacagaaggctgtcgtggtgaa
ggtggttaccttctaaacaaagacggcgaacgctttatggaacgttacgctccaaacgcg
aaagaccttgctggtcgcgacgttgttgctcgctctatgatgattgaaatccgtgaaggc
cgcggttgtgatggaccttggggtccacatatcaagttgaaacttgatcatcttggcaaa
gaagtacttgaatcacgtctgccaggtatttgtgaactgtctcgtacattcgcacacgtt
gatccagtgaaagaaccaattccagtaattccaacttgtcactacatgatgggtggtgtt
ccaactcaagtttctggtcaagcgattaagcaacttgcggatggcagcgaagcggaagtt
caaggtctatacgcttgtggtgaaattgcttctgtgtctgtacacggtgcaaaccgtcta
ggtggtaactcactgcttgatttggtggtatttggtcgtgcaacaggcctacacctaggt
gagactcttgctgctcaagttgaagctcgccctgcaactgaatcagacatcgaagcttct
ctagcgcgcactatgcgttgggaaaatagcactggtggcgaagatccagtacaaatccgt
aaagacctacaacgctgtatgcaaaacagcttctcggtattccgagaaggtgatgcaatg
gcgacgggcctagaagagttgaaggtaattcgtgaacgtctgaaagatgctcacttagcc
gacaaatcttctgagttcaacacgcaacgtattgagtgtctagaactagataacctgatg
gaaaccgcgttctcaacagcagttgcagcaaactaccgtacagaaagccgtggtgctcat
gctcgcttcgacttccctgagcgtgatgatgagaactggctatgccactctatctacaac
ccggaaaccgaagcgatgacaaagcgtgatgtaaacatgacgccagtacaccgtgacgcg
ttcccaccgaaagtacgtacatactaa

DBGET integrated database retrieval system