KEGG   Vibrio parahaemolyticus UCM-V493: VPUCM_2863Help
Entry
VPUCM_2863        CDS       T03116                                 

Definition
(GenBank) Phosphoenolpyruvate carboxylase
  KO
K01595  phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
vph  Vibrio parahaemolyticus UCM-V493
Pathway
vph00620  Pyruvate metabolism
vph00680  Methane metabolism
vph01100  Metabolic pathways
vph01120  Microbial metabolism in diverse environments
vph01200  Carbon metabolism
Module
vph_M00168  CAM (Crassulacean acid metabolism), dark
Brite
KEGG Orthology (KO) [BR:vph00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    VPUCM_2863
  Energy metabolism
   00680 Methane metabolism
    VPUCM_2863
Enzymes [BR:vph01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     VPUCM_2863
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEPcase PEPcase_2 DUF349
Motif
Other DBs
NCBI-ProteinID: AHJ00822
LinkDB All DBs
Position
1:3109148..3111781
Genome map
AA seq 877 aa AA seqDB search
MNEKYAALKSNVRMLGHLLGNTIRDAHGEEIFEKVETIRKLSKSAQAGNQADRESLIEEI
KHLPDEQLTPVTRAFNQFLNLTNIAEQYHTISRHCEEHICEPDAINSLFSKLVQNDVSKL
DTAQAVRDLNIELVLTAHPTEITRRTMINKLVKINECLSKLELSDLSSKERKKTERRLEQ
LIAQSWHSDVIRQQRPTPLDEAKWGFAVVENSLWEAVPDFLREMNDRLKSYLGEGLPIDA
RPVHFSSWMGGDRDGNPFVTHSVTREVLLLSRWKAADLYLNDINELISELSMTVSNDQVR
ELAGEDQHEPYRAILKQLRALLNETKDILDAKIHGQKLAVKAPLQKVEQLWDPLYACYQS
LHECGMGVIADGSLLDTLRRVKAFGVHLVRLDIRQESTRHADVLSELTRYLGIGDYEQWS
EQDKIAFLTNELASKRPLLPRDWEPSEPVKEVLDTCKIIALQPREAFGAYVISMARTASD
VLAVHLLLQEAGCPYRMDVCPLFETLDDLNNAESVIKQLMSIDLYRGFIQNHQMVMIGYS
DSAKDAGVMSAGWAQYHAMESLVKVAEDEGVELTLFHGRGGTVGRGGAPAHAALLSQPPK
SLKGGLRVTEQGEMIRFKLGLPDVAVNSFNLYASAILEANLLPPPEPKQEWRDLMEVLSE
VSCEAYRGVVRGEPDFVPYFRQATPELELGKLPLGSRPAKRNPNGGVESLRAIPWIFSWS
QNRLVLPAWLGAGEAIQYSVDKGHQALLEEMCREWPFFSTRLGMLEMVYTKCNMEISRYY
DQRLVEPQLQPLGDRLREQLQRDIKSVLNVENNENLMQSDPWGQESIRLRNIYVEPLNML
QAELLYRTRQTEEASANLEEALMVTIAGIAAGMRNTG
NT seq 2634 nt NT seq  +upstreamnt  +downstreamnt
atgaacgagaaatacgccgcacttaaaagcaatgtgcgcatgttaggccacttactgggt
aacacgattcgcgatgcccacggcgaagaaatcttcgagaaagtggagaccattcgtaaa
ttatccaaatcggctcaagcaggtaatcaagcggacagggaaagcttgatagaagaaatc
aaacacctacccgatgagcaactaacgccagtcacccgtgcgtttaaccaatttctaaac
ctcaccaatattgccgagcaataccacaccatttcacgtcactgtgaagagcacatctgt
gaaccagacgcgatcaactcgctgttttcaaaactggtacaaaacgatgttagcaaactc
gatacggctcaagcggtacgtgatttgaatattgaactggtattaaccgcgcacccaacg
gaaatcactcgccgcaccatgatcaataaactggtcaagatcaacgagtgtttatccaaa
ctagaactcagcgacctgtcttctaaagaacgcaaaaaaacagagcgtcgcttagagcaa
cttatagcacaaagctggcattctgacgtgattcgtcaacaacgccctactccattggat
gaagcgaaatggggctttgccgtagtagaaaactcactgtgggaagctgtgccagatttc
ctacgtgaaatgaatgatcgtctgaagtcttacctaggtgaaggtttaccaattgatgct
cgtccagtgcatttctcttcttggatggggggtgaccgtgatggcaacccgttcgttact
catagcgtaacacgtgaagtattgcttctgtctcgttggaaagccgctgacctttatctc
aatgacatcaatgaattgatcagcgaactctcgatgactgtttctaacgatcaagttcgt
gaacttgctggtgaagatcaacacgaaccataccgcgcaatcctgaaacaactacgtgct
ctgctcaatgaaaccaaagatattcttgatgcgaagatccacggtcaaaaactggcagtc
aaagcaccgctacaaaaagttgaacagctttgggatcctctgtacgcgtgttaccaatca
ctgcatgagtgcggcatgggcgtcatcgctgacggctcgttgctagatacgctgcgtcgt
gtgaaagcgtttggcgttcacctagttcgtcttgatatccgccaggaaagtacgcgccac
gcagatgtactctctgagctgactcgatacctcggcattggtgattacgaacagtggagc
gagcaagataaaattgctttcctcaccaatgaacttgcgtctaaacgtccgctactgccg
cgcgattgggaaccatcagagcctgtcaaagaggtgttagacacctgtaagatcatcgct
ctgcaaccgcgagaagcgttcggtgcttacgtcatctcaatggctcgtaccgcctcagac
gtactcgctgtgcacctattactgcaagaagcgggctgcccttaccgtatggatgtttgt
cctctgttcgaaactctagacgacttgaacaatgcagagtcggtcattaagcagctaatg
agcatcgacctttaccgtggctttattcaaaaccaccaaatggtcatgatcggctactct
gattcagcaaaagatgcaggcgtcatgtcggcaggctgggctcagtaccatgctatggaa
tctctagttaaagtggcagaagacgaaggtgttgagctgacgctgttccatggtcgtggc
ggcaccgttggtcgcggcggcgcacctgcacacgcggctctgctgtctcaaccaccaaag
agcttgaaaggcgggttacgcgtaacagaacaaggcgaaatgatccgctttaaactgggt
ctaccagacgttgcggtaaacagcttcaacttgtatgcaagcgccattttggaagcaaat
ctactgccaccaccagagccaaaacaagaatggcgcgacttgatggaagtcctgtcggaa
gtgagctgtgaagcttaccgtggcgtcgtccgtggtgaaccagattttgttccttacttc
cgtcaagcaacgcctgaactagagctaggcaaactgccgcttggttcacgcccagcgaaa
cgtaatccaaatggcggtgtagaaagcttacgtgcaattccttggatcttctcgtggagc
caaaaccgtttggtgcttccggcttggttaggcgcaggtgaagctattcagtactcagta
gacaaaggtcatcaggcgctactggaagaaatgtgtcgcgaatggccgttcttctcaact
cgcctaggtatgcttgagatggtgtacaccaagtgcaacatggaaatctctcgctactat
gaccaacgcctagttgaacctcaacttcaaccattgggtgaccgactgcgtgaacagctt
caacgtgatattaagtccgtactgaacgtagagaacaacgaaaacctaatgcaaagcgac
ccatggggccaagaatcaattcgcctacgtaacatctacgtagagccattgaacatgctt
caagctgaattgctataccgtactcgtcaaacagaagaggcgtctgcaaaccttgaagag
gctctgatggtgaccatcgcgggtattgcagcaggtatgcgtaatacgggttaa

DBGET integrated database retrieval system