KEGG   Vagococcus penaei: BW732_03935Help
Entry
BW732_03935       CDS       T04715                                 

Definition
(GenBank) glutamate decarboxylase
  KO
K01580  glutamate decarboxylase [EC:4.1.1.15]
Organism
vpi  Vagococcus penaei
Pathway
vpi00250  Alanine, aspartate and glutamate metabolism
vpi00410  beta-Alanine metabolism
vpi00430  Taurine and hypotaurine metabolism
vpi00650  Butanoate metabolism
vpi01100  Metabolic pathways
vpi01110  Biosynthesis of secondary metabolites
vpi01120  Microbial metabolism in diverse environments
vpi02024  Quorum sensing
Brite
KEGG Orthology (KO) [BR:vpi00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    BW732_03935
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    BW732_03935
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    BW732_03935
   00430 Taurine and hypotaurine metabolism
    BW732_03935
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    BW732_03935
Enzymes [BR:vpi01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.15  glutamate decarboxylase
     BW732_03935
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyridoxal_deC Aminotran_5 Mg296
Motif
Other DBs
NCBI-ProteinID: AQP53473
UniProt: A0A1Q2D510
LinkDB All DBs
Position
complement(831009..832388)
Genome map
AA seq 459 aa AA seqDB search
MTTNNETTPIFGTSISERDVIMKKLHDNPVEPDVAYRLVKDQLIDEGNARQNLATFCQTY
MDPEATKLMAETMEKNAIDKSEYPETAKLETSCVNILGDLWNAPDSERIMGTSTVGSSEA
CMLGGMAMKFRWRHLAEKRGLDIQAKKPNLVISSGYQVCWEKFCVYWDIEMREVPMDMDH
LSIDTDKVLDYVDDYTIGIVGILGITYTGKFDDIKALDDLVTTYNETHEHELVIHVDGAS
GAMFVPFVDPELAWDFRLKNVVSINTSGHKYGLVYPGIGWILWRDKEYLPEELIFDVSYL
GGVMPTMAINFSRSASQIIGQYYNFYRYGFNGYKEIHTRTRHAAETIAKAVQKSGYFDMI
NMGDNLPIVCYKLKEDADVEWTLYDLADRLLMKGWQVPAYPLPANLDNQVIQRFVCRADL
GENLADELIHDFNQCLEDLKHARILYHDKGEVKTQGFTH
NT seq 1380 nt NT seq  +upstreamnt  +downstreamnt
atgacaacaaataatgaaacaaccccaatttttggaacatcaatctctgaacgagatgta
attatgaaaaaattacatgacaatccggttgagccagatgttgcttaccgtttggtgaaa
gatcaattgatagatgaaggaaatgcaagacaaaatttagcgacattttgtcaaacttat
atggacccagaagcaactaaactaatggctgaaacaatggaaaaaaatgccattgataag
tctgaatatcctgaaacagctaagttagaaacaagttgtgtcaatattttaggtgattta
tggaatgctccagattcagaacgcattatgggaacctcaacagttggatcaagtgaggcc
tgtatgctaggtgggatggcaatgaaatttcgctggcgtcaccttgcagaaaaacgtggg
ttagatatccaagctaaaaaaccgaatctggttatttcatcaggatatcaagtctgttgg
gaaaaattctgtgtttattgggatattgaaatgcgtgaagtaccaatggatatggatcat
ttaagtattgatactgataaagtacttgattacgtcgatgattacacaattggtattgtt
ggtattctaggtattacatacactggaaaatttgatgacattaaagcactagacgattta
gtaacaacttataatgaaacgcatgagcacgaattagttattcatgtggatggtgcgagt
ggggcaatgtttgtaccatttgttgatccagaactagcttgggacttccgtttgaaaaat
gtggtatcgattaatacttctggtcataaatacggtttagtgtaccctggtattggttgg
attctctggcgtgacaaagaatatttaccagaagaattaatatttgatgttagctattta
ggtggtgtaatgcccacaatggcaattaatttctctcgaagtgctagtcaaattattggt
caatactataatttctatcgttatggtttcaatggttataaagaaattcatacacgtaca
cgtcatgcagcagaaacaattgcaaaagctgtgcaaaaatcgggatattttgatatgata
aatatgggtgataatctacctattgtgtgttataaattaaaagaagatgctgatgttgaa
tggacactttatgatttagctgatagattactaatgaagggttggcaagtgccagcgtat
cctttacctgctaatttagataatcaagtgattcaacgatttgtttgtcgagcagactta
ggtgaaaacttggcagatgaattaattcatgactttaatcagtgtctagaagatttaaaa
catgcacgtattttgtatcatgacaaaggtgaagtaaaaacacaagggttcacacactaa

DBGET integrated database retrieval system