KEGG   Vibrio parahaemolyticus O1 K33 CDC_K4557: M636_03885Help
Entry
M636_03885        CDS       T02760                                 

Definition
(GenBank) D-alanine--D-alanine ligase
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
vpk  Vibrio parahaemolyticus O1:K33 CDC_K4557
Pathway
vpk00473  D-Alanine metabolism
vpk00550  Peptidoglycan biosynthesis
vpk01100  Metabolic pathways
vpk01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:vpk00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    M636_03885
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    M636_03885
 09160 Human Diseases
  09175 Drug resistance: Antimicrobial
   01502 Vancomycin resistance
    M636_03885
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:vpk01011]
    M636_03885
Enzymes [BR:vpk01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     M636_03885
Peptidoglycan biosynthesis and degradation proteins [BR:vpk01011]
 Precursor biosynthesis
  Amino acid ligase
   M636_03885
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N ATP-grasp CPSase_L_D2 ATPgrasp_ST Peptidase_M55
Motif
Other DBs
NCBI-ProteinID: AGQ96477
LinkDB All DBs
Position
II:863341..864330
Genome map
AA seq 329 aa AA seqDB search
MIKNILLLCGGGSSEHEISLLSANFVEQQLNLIQNVKVTRVEIKNEGWVTDQGELVYLDL
NTKQLCSNESNQTIDFIVPCIHGFPGETGDIQSLFEIAGIPYLGCGPEASSNSFNKITSK
LWYDALDIPNTPYLFLTRNDEHAHRQAEQAFEKWGKVFVKAARQGSSVGCYSVTEKQAIA
KAVNDAFGYSDQVLVEKAVKPRELEVAAYEMNGELHITKPGEVIAPDGAFYSYDEKYSSS
SHSLTEVEAKNLTQEQIDKIRHASETVFKQMNLRHLSRIDFFLTEDNEIYLNEVNTFPGM
TPISMFPKMLQNNGHKFHEFLEDCINSAK
NT seq 990 nt NT seq  +upstreamnt  +downstreamnt
atgattaaaaatattcttctattatgcggcggcggctcttctgaacacgaaatttcactg
ttgtcggctaactttgttgaacaacaactaaacctaattcagaacgtcaaagtcactcgc
gtagaaataaaaaatgaaggttgggttacagatcaaggcgaattggtttaccttgattta
aacaccaaacaattgtgctcgaatgaatccaatcaaacgatcgactttattgtgccttgt
attcacggctttcctggcgagactggtgacattcaatcactattcgaaattgccggtatt
ccatacttaggatgtggaccagaagcaagcagcaacagtttcaataaaatcacatcaaaa
ctttggtacgacgctttagacattccaaatacaccttacttattcctaactcgcaatgat
gaacacgctcacagacaagctgaacaagcctttgaaaagtggggaaaagtgtttgttaaa
gctgcacgtcagggctcgtctgttgggtgttacagtgtaaccgagaagcaagctatcgct
aaagcagtaaacgatgcgtttggttattcagatcaagtacttgtagagaaagcggtaaaa
cctcgtgagttagaagtcgcagcttatgaaatgaacggtgaactgcacatcactaagcca
ggtgaagtgatcgcacccgatggtgcattttactcatacgatgaaaaatacagcagctca
agccattcattaacagaagtagaagcgaagaacctgactcaagaacagatcgataagatt
cgtcatgcgtcagaaaccgtattcaaacaaatgaaccttcgtcatttgtctcgcatcgac
tttttccttacggaagataacgaaatttacttgaatgaagtgaatacattcccaggaatg
acaccaatttcaatgttccctaaaatgcttcaaaacaatggtcacaagttccatgagttt
cttgaagattgtattaatagtgcaaagtga

DBGET integrated database retrieval system