KEGG   Vibrio parahaemolyticus O1 K33 CDC_K4557: M636_15620Help
Entry
M636_15620        CDS       T02760                                 

Definition
(GenBank) glutamate decarboxylase
  KO
K01580  glutamate decarboxylase [EC:4.1.1.15]
Organism
vpk  Vibrio parahaemolyticus O1:K33 CDC_K4557
Pathway
vpk00250  Alanine, aspartate and glutamate metabolism
vpk00410  beta-Alanine metabolism
vpk00430  Taurine and hypotaurine metabolism
vpk00650  Butanoate metabolism
vpk01100  Metabolic pathways
vpk01110  Biosynthesis of secondary metabolites
vpk01120  Microbial metabolism in diverse environments
vpk02024  Quorum sensing
Module
vpk_M00027  GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:vpk00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    M636_15620
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    M636_15620
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    M636_15620
   00430 Taurine and hypotaurine metabolism
    M636_15620
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    M636_15620
Enzymes [BR:vpk01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.15  glutamate decarboxylase
     M636_15620
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyridoxal_deC Beta_elim_lyase Aminotran_5 SepSecS Aminotran_1_2 HSCB_C AAA_33
Motif
Other DBs
NCBI-ProteinID: AGQ98603
LinkDB All DBs
Position
I:1591055..1592701
Genome map
AA seq 548 aa AA seqDB search
MVKEQKTADVSFESLLKIFTVPEGPDSTLTKIDESLSRNLNQFLREHIVAEEKPLREIEK
DFSSAQIPEQPEFVSDHTEHLLDTLVSHSVHTSAPSFIGHMTSALPYFLMPLSKIMIALN
QNLVKIETSKAFTPLERQVLGMLHRLIYGQNDKFYRKWMHSANHSLGAFCSGGTIANITA
LWVARNKALKADGDFKGVEKEGLFKAMKYYGYEGLAVLVSERGHYSLKKAADVLGLGQEG
LVAVKTDANNRIVVDDLKAKIAELKEQNIKPIAVIGVAGTTETGNVDPLSQIAQVCQEHN
CHFHVDAAWGGATLMSNHYRHLLEGVELADSVTIDAHKQLYIPMGAGMVLFKDPDAMKSI
EHHAQYILRKGSKDLGSHTLEGSRSGMAMLVYAAMHIISRPGYELLIDQSIEKARYFADL
IKQQDDFELVSEPELCLLTYRYLPPLIREALDKAEGTQKEKLNELINQLTQFIQKRQRET
GKSFVSRTRLNPDQWQRMNTIVFRVVLANPLTTRDILSSVLDEQREIAKQAPSLTAKIEE
MASDILGA
NT seq 1647 nt NT seq  +upstreamnt  +downstreamnt
atggttaaggaacaaaaaaccgctgacgttagctttgagagcttgctaaagatcttcacc
gtacctgaaggtcctgattctacgttgacaaaaattgacgaaagtctctcccgaaacttg
aaccaatttcttcgtgaacacatcgtggcagaagaaaagcctttacgtgaaatcgagaaa
gacttttcttctgctcagattccagagcaacctgaattcgtgtcagatcacaccgagcac
ctgctagacacgttagtgtcgcactcggttcacacttcagccccaagttttatcggtcac
atgacctcggcgctaccctacttcttgatgcctttatccaagatcatgatcgcgctaaac
caaaacttggttaagatcgaaacatcaaaagcattcacacctcttgaacgtcaagtttta
gggatgttacaccgcttaatttacggtcaaaacgacaagttttatcgtaaatggatgcac
agcgcgaaccattcacttggtgcgttttgctctggtggcacaatcgcgaacattacggcg
ctttgggttgcacgcaataaagcgttgaaagcagatggtgatttcaaaggggtagaaaaa
gaaggtctattcaaagccatgaagtactatggctacgaaggccttgcagttctggtttct
gaacgtggtcactattcactgaaaaaagcagcagacgtacttggcttaggtcaagagggt
ttagtcgcggtgaaaaccgatgcaaacaaccgtattgttgttgacgacctaaaagcaaaa
attgccgagcttaaagaacaaaacatcaaaccaattgcggttatcggtgtcgctggcaca
acagaaacggggaacgtcgatcctctgtcgcagatcgctcaagtgtgccaagagcacaat
tgtcacttccatgtagatgccgcttggggtggtgcaacgttgatgtctaatcattaccgt
caccttctcgaaggtgttgaactggctgactcagtgactatcgacgcgcacaaacaactg
tacatccctatgggtgcaggcatggtgttgttcaaagacccagacgcgatgaaatccatt
gaacaccatgcgcaatacatcttacgtaaaggttcaaaagatttaggtagtcatacacta
gaaggctctcgctcaggcatggccatgttagtgtatgcggcgatgcacattattagtcgc
ccaggctacgaactattgatcgatcaaagtatcgagaaagcgcgctactttgctgacctc
atcaaacagcaagatgacttcgaactcgtttctgaaccggagctttgcctactgacctac
cgctatctaccgccattgattcgtgaagcgctagataaagcggaaggtactcaaaaggaa
aaactaaacgagctcatcaaccagctcacgcagtttatccagaagcgtcaacgtgaaacg
ggcaaatcgtttgtttctcgtacaagactgaaccctgaccaatggcaaagaatgaacacc
atcgtattccgagtggtactagccaacccattgacgaccagagatatcttgagctcagta
ctggacgaacaacgcgaaatcgccaaacaagcaccaagtttgacagcaaaaatcgaagaa
atggcctcagatattttaggcgcgtaa

DBGET integrated database retrieval system