KEGG   Vibrio parahaemolyticus O1 K33 CDC_K4557: M636_19515Help
Entry
M636_19515        CDS       T02760                                 

Gene name
murC
Definition
(GenBank) UDP-N-acetylmuramate--alanine ligase
  KO
K01924  UDP-N-acetylmuramate--alanine ligase [EC:6.3.2.8]
Organism
vpk  Vibrio parahaemolyticus O1:K33 CDC_K4557
Pathway
vpk00471  D-Glutamine and D-glutamate metabolism
vpk00550  Peptidoglycan biosynthesis
vpk01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:vpk00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00471 D-Glutamine and D-glutamate metabolism
    M636_19515 (murC)
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    M636_19515 (murC)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:vpk01011]
    M636_19515 (murC)
Enzymes [BR:vpk01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.8  UDP-N-acetylmuramate---L-alanine ligase
     M636_19515 (murC)
Peptidoglycan biosynthesis and degradation proteins [BR:vpk01011]
 Precursor biosynthesis
  Amino acid ligase
   M636_19515 (murC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Mur_ligase_M Mur_ligase Mur_ligase_C BRCT
Motif
Other DBs
NCBI-ProteinID: AGR00290
LinkDB All DBs
Position
I:complement(2439759..2441216)
Genome map
AA seq 485 aa AA seqDB search
MTIQHTQDLAQIRAMVPEMRRVKCIHFIGIGGAGMSGIAEVLLNEGYEITGSDLSENPVT
ERLVSKGATVFIGHQASNVEKASVVVVSTAINEENPEVMAARELRIPIVRRAEMLAELMR
FRHGIAVAGTHGKTTTTALVTQIYSEAGLDPTFVNGGLVKSAGTNARLGSSRILIAEADE
SDASFLHLQPMVSIVTNIEADHMDTYGGDFETLKQTFIDFLHNLPFYGQAIVCIDDPVIR
ELIPRISRQVITYGFSDDADVRIENYHQEGQQGKFTVVRKGRANLDITLNIPGRHNALNA
SAAIAVATEDDIEDDAILKAMAGTQGTGRRFDHLGEFDTGNGHAMLVDDYGHHPTEVDVT
INAARSGWQDKRLVMIFQPHRYSRTRDLYDDFANVLEQVDVLIMLDVYAAGEKPIAGADG
RSLCRTIRSRGKVDPIFVPEIEQLPSVLANVIQDGDLILTQGAGDVGKVAKQLANLELNI
NKMLG
NT seq 1458 nt NT seq  +upstreamnt  +downstreamnt
atgactatccaacatacacaagacctagctcagattcgcgcgatggtaccagaaatgcgt
cgcgtgaaatgcatccacttcatcggtatcggtggtgcgggcatgagcggcattgctgaa
gttcttctaaacgaaggttatgaaatcacgggttcagacttgtctgaaaacccagtaacc
gagcgcttagtgtcgaaaggggcaaccgtatttattggtcaccaagcaagtaatgtcgaa
aaggctagtgtggtagtcgtttccaccgcgattaacgaggaaaaccctgaagtcatggcg
gctcgtgaattgcgtattcctattgttcgccgagcagaaatgttggctgaactgatgcga
ttccgtcatggtatcgctgttgcgggcacacatggtaaaaccaccaccacagcactagtc
acacaaatctattccgaagcaggccttgatccaacgtttgtaaacggcggtctagtaaag
agcgcgggcacaaatgcgcgcttgggctctagccgtattctgattgcagaagcggatgag
agcgacgcctctttcttgcacctgcaacctatggtgagcatcgttaccaacatcgaagct
gaccacatggatacctacggtggtgacttcgaaacattgaaacaaaccttcattgatttt
cttcacaacctgccgttttatggccaagccattgtctgtatcgatgatccagtgattcgt
gagctgattccgcgtattagccgtcaagtgatcacctacggcttttctgacgatgcggac
gtacgtatcgaaaattatcatcaagaaggtcagcaaggtaaatttacagtagtacgtaaa
ggtcgagctaacctcgatatcacgctaaacattccaggccgtcacaatgcgttgaacgca
tcagcagcaatagcggtcgcaacggaagacgacattgaagatgacgcgattctaaaagcg
atggcgggtactcaaggtactggtcgccgttttgatcaccttggtgagtttgatacaggt
aacggtcatgcgatgttagtcgatgattacggtcatcacccaacggaagttgacgtcacc
attaatgcagctcgcagtggttggcaagataagcgattggttatgattttccaaccacat
cgttacagtcgcactcgtgacctttacgatgattttgcaaacgtgcttgagcaggttgat
gtattgatcatgcttgacgtgtatgccgcgggtgaaaaaccaattgctggcgcggatgga
cgctctttgtgccgtacgattcgcagccgaggtaaagtagatccgatttttgttccagaa
atcgagcaattaccatcagttttggctaacgttatacaagacggcgacctaattttaacg
caaggtgctggtgatgttggtaaagttgccaaacagctggctaatcttgagttaaatata
aacaagatgcttggataa

DBGET integrated database retrieval system