KEGG   Virgibacillus dokdonensis: A21D_00209Help
Entry
A21D_00209        CDS       T05261                                 

Gene name
yfmT
Definition
(GenBank) Putative aldehyde dehydrogenase YfmT
  KO
K21802  vanillin dehydrogenase [EC:1.2.1.67]
Organism
vpn  Virgibacillus dokdonensis
Pathway
vpn00627  Aminobenzoate degradation
vpn01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:vpn00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00627 Aminobenzoate degradation
    A21D_00209 (yfmT)
Enzymes [BR:vpn01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.67  vanillin dehydrogenase
     A21D_00209 (yfmT)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh
Motif
Other DBs
NCBI-ProteinID: AUJ23323
UniProt: A0A2K9IX30
LinkDB All DBs
Position
196253..197710
Genome map
AA seq 485 aa AA seqDB search
MSFKKLPSQYINGVWKEGASPLIMENKNPYNGDLLATYRAGSKKDLDDAYQAANAAQKQW
EKTNPVTKREVFENAVQYINDNYESIVKIIIEEIGGTRLKAEFEIGLVTNIIKEATTFPF
RMDGKILTSPIDDKENRVYRVPVGVVGVISPFNFPFFLSMKSVATALATGNGVVLKPHEH
TPITGGTMIASIFEHAGLPKGLLNVITTEISEIGDDFVAHPIPRAISFTGSTKVGKHIGA
IAGKHLKDAHLELGGNSALIVLEDADIDLAVSAAVFSRFTHQGQICMSANRLIIHEAVYN
EFVEKYVAKVATLPCGDPKDPNTIIGPLINQQQVETTKAFITKAIEDGAKPILQGKIEGN
VIEPVIFTDVTPTMSIAKEEVFAPVVSILQASNDEEAISIANDTLYGLSGAIHTRDVERG
AELAKQLDTGMIHINDGTINDEPHVAFGGMKNSGLGRLNGEWSLDAFTTFKWISVQHKAR
NYPYS
NT seq 1458 nt NT seq  +upstreamnt  +downstreamnt
atgtcatttaaaaaattgccaagtcaatatattaacggcgtgtggaaagagggggcttct
ccccttattatggaaaacaaaaacccttataatggcgaccttctcgccacatatcgtgca
ggcagtaaaaaagatttggatgatgcttatcaagctgcaaatgcggcacagaaacaatgg
gaaaaaaccaaccctgttactaagcgcgaggtgtttgaaaacgcagttcaatatataaac
gataactatgaatccattgttaaaataataatagaagagattggtgggacaaggttaaaa
gcagaatttgaaataggacttgtaaccaacatcataaaagaagctaccacatttcctttt
cgaatggatgggaaaatcttaacctcccctatcgatgataaggaaaatagagtttaccgt
gttcctgtaggtgttgttggcgtaatcagcccattcaattttccatttttcttatccatg
aaatcggtagcaacagcattggcaactggtaatggagttgtgctaaaaccccatgaacat
acaccaattactggtggaacaatgattgcatctatttttgaacatgctggattaccaaaa
ggtctactcaatgtaatcacaacagaaatttcggaaattggggatgactttgttgcacac
cctatccctcgagctatttcttttaccggctccacaaaagttggaaaacatatcggtgcc
attgcaggaaaacatttaaaggatgcacacttagaattaggaggaaatagtgcattaata
gtattagaagacgcggacattgatttagcggtaagtgctgctgtatttagtcgttttacg
caccaagggcaaatttgcatgtctgcgaatcgcttaattatacatgaagcagtttataac
gaatttgttgaaaaatatgtagcgaaagtagctacattaccgtgcggagatcccaaagat
ccaaacaccattattgggccgttaattaatcaacagcaagtagaaacaactaaagctttc
attactaaagcaatagaagatggagccaagcctattcttcaaggaaaaatagagggaaat
gtgatagaacctgtgatcttcacagatgtgactcctactatgtctatagcaaaagaggaa
gtatttgcccctgttgtatctattttacaagcatcaaacgacgaagaagccatttctatt
gcaaatgataccttatatggtctaagtggagctattcatacaagagacgttgagcgtggt
gcagagcttgcaaagcaattagatacagggatgatccacattaatgacgggaccattaac
gacgagcctcatgtcgcatttgggggaatgaaaaattcaggtttaggacgtttaaatggg
gaatggagcttagatgcctttactacttttaaatggattagcgttcagcacaaggctaga
aactatccatatagttaa

DBGET integrated database retrieval system