KEGG   Virgibacillus dokdonensis: A21D_02492Help
Entry
A21D_02492        CDS       T05261                                 

Gene name
gutB_1
Definition
(GenBank) Sorbitol dehydrogenase
  KO
K00004  (R,R)-butanediol dehydrogenase / meso-butanediol dehydrogenase / diacetyl reductase [EC:1.1.1.4 1.1.1.- 1.1.1.303]
Organism
vpn  Virgibacillus dokdonensis
Pathway
vpn00650  Butanoate metabolism
Brite
KEGG Orthology (KO) [BR:vpn00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    A21D_02492 (gutB_1)
Enzymes [BR:vpn01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.4  (R,R)-butanediol dehydrogenase
     A21D_02492 (gutB_1)
    1.1.1.303  diacetyl reductase [(R)-acetoin forming]
     A21D_02492 (gutB_1)
    1.1.1.-  
     A21D_02492 (gutB_1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_zinc_N ADH_N Glu_dehyd_C ADH_zinc_N_2 ADH_N_assoc AlaDh_PNT_C UDPG_MGDP_dh_N 2-Hacid_dh_C Methyltransf_25 TrkA_N AstA
Motif
Other DBs
NCBI-ProteinID: AUJ25539
UniProt: A0A2K9J0T4
LinkDB All DBs
Position
complement(2679690..2680739)
Genome map
AA seq 349 aa AA seqDB search
MKAAVWYGQKDIRVEEREQKPLKDTEVKVKVAWAGLCGSDLHEYEEGPVFIPTEKEDELA
GGIAPLTMGHEFAGVIEEVGAKVTNFKPGDRVAVNPTITHGDKSEDLDPYDGFSFVGLHT
DGGFTSFANVPENNVYLLPEPLTLQDGALIEPTAVAVQAVKEAGMQFGDTVAVFGAGPIG
LLTILAARAAGASKIIALDLSETRLEKAKEVGATHVINSGETDPVKAVFDIVPEGVNASF
EVAGVAPTFKQSIEVTKPRGTMVIVSIFARPIEWNPMQLTGKGVKITSTIAYTPTSFQQT
IDLMASGQLKPQSIITNQIQLDDIVEKGFELLSTDKSQAKILIELSGEK
NT seq 1050 nt NT seq  +upstreamnt  +downstreamnt
atgaaagcagcagtatggtatggacaaaaagacattcgcgtagaagaaagagaacaaaaa
ccattaaaagacacagaggttaaagtaaaggttgcatgggctggtctatgcggtagtgac
ttacatgagtatgaagaaggtccagtatttattccaacagaaaaagaagatgaattagct
ggtggtattgcgccgcttaccatggggcatgaatttgctggtgtcattgaagaagttggg
gcaaaggtaacaaacttcaaaccaggcgaccgcgtagctgtaaatccaactattacgcat
ggcgacaaatcagaagatcttgatccatatgatggtttttcttttgtaggcttgcacaca
gatggtggattcacatcttttgccaatgttccagaaaacaacgtgtatcttttaccagaa
ccattaactttacaagatggggcattaattgaacctacagcagtagcagttcaagctgtg
aaagaagctggcatgcaatttggcgacactgttgcagtatttggtgctggtccaattggt
ttgttaaccatcctagcagcaagagcagctggagcaagcaaaattatcgcattagactta
tctgaaacacgtttagaaaaagcaaaagaagttggtgcgacacacgtcattaattcaggg
gaaacagatccagtaaaagctgttttcgatatcgtacctgagggtgtcaatgcttcattt
gaagttgctggtgtagcgcctactttcaaacaatctattgaagtaacaaaaccacgtgga
acgatggtcatcgtttctatttttgctagaccaattgagtggaacccaatgcaactaact
ggaaaaggtgtgaaaatcacttctactattgcgtacacaccaacatctttccaacaaaca
atcgacttaatggcaagtggacaattaaaaccacaatccattattactaaccaaattcaa
ttagatgacatcgtagaaaaaggatttgaattattatctacagataagtctcaagctaaa
attttaattgagctaagtggcgaaaaataa

DBGET integrated database retrieval system