KEGG   Virgibacillus dokdonensis: A21D_02705Help
Entry
A21D_02705        CDS       T05261                                 

Gene name
comK_2
Definition
(GenBank) Competence transcription factor
  KO
K02250  competence protein ComK
Organism
vpn  Virgibacillus dokdonensis
Pathway
vpn02024  Quorum sensing
Brite
KEGG Orthology (KO) [BR:vpn00001]
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    A21D_02705 (comK_2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:vpn03000]
    A21D_02705 (comK_2)
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:vpn02044]
    A21D_02705 (comK_2)
Transcription factors [BR:vpn03000]
 Prokaryotic Type
  Other transcription factors
   Others
    A21D_02705 (comK_2)
Secretion system [BR:vpn02044]
 Type II secretion system
  Competence-related DNA transformation transporter (DNA-T) related proteins
   A21D_02705 (comK_2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ComK
Motif
Other DBs
NCBI-ProteinID: AUJ25751
UniProt: A0A2K9J6B4
LinkDB All DBs
Position
2938145..2938675
Genome map
AA seq 176 aa AA seqDB search
MFNFYTDPPEITPFTAALVARRDSNNKAMTMVLEDQEEYAVGCSPSKVMDHACKYFGSSL
KGRQDGTRDVCGITHKAPVTIDPLSGMYFFPTISPSSSQCTWIAHSHIEQVQRKHEYGTE
IIFLNGKSIELDISYGSMINQIQRTAQFRYLLNNRLKFLKKHIAPSESTFSSTPQT
NT seq 531 nt NT seq  +upstreamnt  +downstreamnt
atgtttaacttctacacagatcctcccgaaatcaccccttttactgctgccttggtagct
cgacgagactccaataacaaagcaatgacgatggtgcttgaagatcaggaagaatatgca
gtcggttgctccccaagtaaggtgatggatcacgcttgtaagtattttggcagcagttta
aaaggaagacaggatggaacgcgtgatgtttgcggtattacccataaagcccccgttaca
attgatccattaagcggcatgtatttttttccaacgatttctccttcgagctctcagtgt
acatggattgcccattcccatatcgaacaagttcaaagaaagcatgaatatgggacggaa
attatctttctaaatggaaaaagcattgaattagacatttcctatgggtcgatgataaac
caaattcagcgaacagctcaatttcggtatttattaaataaccgactcaagtttttaaag
aagcacattgctccttcagaatcgactttctcatcaactcctcaaacataa

DBGET integrated database retrieval system