KEGG   Virgibacillus dokdonensis: A21D_03222Help
Entry
A21D_03222        CDS       T05261                                 

Gene name
sodA
Definition
(GenBank) Mn superoxide dismutase
  KO
K04564  superoxide dismutase, Fe-Mn family [EC:1.15.1.1]
Organism
vpn  Virgibacillus dokdonensis
Brite
Enzymes [BR:vpn01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     A21D_03222 (sodA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sod_Fe_C Sod_Fe_N AHSP Trypan_glycop
Motif
Other DBs
NCBI-ProteinID: AUJ26256
UniProt: A0A2K9J308
LinkDB All DBs
Position
3477833..3478444
Genome map
AA seq 203 aa AA seqDB search
MATFELPELPYAYDALEPTIDKETMNIHHTKHHNTYVTKLNSALEGHAELQNKSLQDLIS
NLDAVPENIRTAVRNNGGGHANHSLFWKVLSPNGGGEPTGELATKIDEAFGSFDKFKEQF
ESAAAGRFGSGWAWLVLHNGNLEIMSTPNQDSPLMEGKTPIFGVDVWEHAYYLKYQNRRP
EYLSSIWNVVNWDEVAKNYNEAK
NT seq 612 nt NT seq  +upstreamnt  +downstreamnt
atggctacatttgaattacctgaactaccatatgcttacgatgcacttgagcctacgatt
gacaaggagactatgaacattcaccatacgaagcatcataacacgtatgttactaaatta
aatagtgctctggaagggcatgctgagcttcaaaacaaatcactacaagatttgattagc
aatttagatgctgtaccagaaaacattcgtacagcagttagaaataatggtggtggacat
gctaaccacagtcttttttggaaggttctttcaccaaacggtggcggcgaaccaactggt
gaacttgctacaaaaatagatgaagcgtttggtagctttgataagttcaaagagcaattt
gaaagcgcggcagctggccgctttggatcaggttgggcttggttagtacttcataacgga
aatcttgaaattatgagtactcctaaccaagactctccattaatggaaggtaaaacgcca
atttttggtgtagatgtttgggaacatgcatattacctaaaatatcaaaacagacgtcct
gaatatctttcatccatttggaatgttgttaattgggatgaagtagctaaaaactataac
gaggctaagtaa

DBGET integrated database retrieval system