KEGG   Virgibacillus dokdonensis: A21D_03971Help
Entry
A21D_03971        CDS       T05261                                 

Gene name
pdhC_4
Definition
(GenBank) Dihydrolipoyllysine-residue acetyltransferase component of pyruvate dehydrogenase complex
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
vpn  Virgibacillus dokdonensis
Pathway
vpn00010  Glycolysis / Gluconeogenesis
vpn00020  Citrate cycle (TCA cycle)
vpn00620  Pyruvate metabolism
vpn01100  Metabolic pathways
vpn01110  Biosynthesis of secondary metabolites
vpn01120  Microbial metabolism in diverse environments
vpn01130  Biosynthesis of antibiotics
vpn01200  Carbon metabolism
Module
vpn_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:vpn00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    A21D_03971 (pdhC_4)
   00020 Citrate cycle (TCA cycle)
    A21D_03971 (pdhC_4)
   00620 Pyruvate metabolism
    A21D_03971 (pdhC_4)
Enzymes [BR:vpn01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     A21D_03971 (pdhC_4)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding GCV_H Biotin_lipoyl_2 DUF2120
Motif
Other DBs
NCBI-ProteinID: AUJ27005
UniProt: A0A2K9J5I9
LinkDB All DBs
Position
complement(4236347..4237597)
Genome map
AA seq 416 aa AA seqDB search
MATSILMPKLGMTMTEGTVEEWLKQPGDTVKEGEGIVTISSDKLTSEVEAPADGILLKVI
KEMSEEAEVGEPIGIVGQAGEEVGEATSTSEKEKTEPTAEVQEKAVQQVEQQPEGHQDMK
GPQRKRRISPAARKKAKALSVDISKVTGTGPKGRITRRDIEQVAELQVAATTTEEQVTTK
PAVHEEEAMQVQGMSAMRKSIAANMQHSLESTAQLTLHRKADITNLLAFQKKMRTEAAEN
NLDLKLTLTVFLARAVTLSLQAHPEVNTHLIHDQLHQFEEVHLGIATSLEDGLVVPVVKH
AERLPLGSLAKQMKHVTETAREGKNAELSGATFTISNLGAQGIEYFTPILNPPESGILGV
GTFVQELRLDENEQVKQIISLPLSLTFDHRVLDGAPAAEFLNTIAHYLAKPYLLLL
NT seq 1251 nt NT seq  +upstreamnt  +downstreamnt
atggctacatcgatattaatgccaaaactaggtatgacgatgacagaaggaacggtggaa
gaatggcttaaacaacctggagacaccgtaaaagaaggtgaaggaattgtcacaattagt
tcagataaattaacgagtgaagtagaagctccagctgatggtatattattaaaggtaata
aaagagatgtctgaagaagcagaagttggtgaaccgattggtattgttgggcaagctgga
gaagaagtaggggaagcgacatcgacttctgaaaaagaaaaaactgaaccaacagctgag
gtacaagagaaggcggttcaacaagtagagcagcaacctgaaggacatcaagacatgaaa
ggtccgcaacgaaaaaggcgtatttctccagctgctcgtaaaaaagcaaaagcattatcc
gtagatatttctaaagtaacaggtactggtcctaagggaaggattactagaagagacatt
gagcaagtagctgagctgcaagtagcagcgaccacaacggaagaacaggttacaacaaaa
ccagccgttcatgaagaagaagcaatgcaggttcaaggtatgtcagcaatgagaaaatca
attgctgctaatatgcagcatagcttggaatcaaccgcgcaattaacattacatcggaaa
gctgatataacaaacttacttgcttttcaaaagaaaatgcgcacagaagcagcagagaat
aatttagatttaaagctgacactaacggtatttttagctcgagctgtaacgttaagctta
caagcacatcctgaagtaaatacacatcttattcatgatcagctacaccaatttgaagaa
gtacatttaggtattgcaacctcactagaagatggattggttgttcctgttgtaaaacat
gcggaaagattgccactcggtagcttagcaaagcaaatgaaacatgtcacagaaactgct
cgtgaaggaaaaaatgctgaattaagcggagcaacattcaccatttctaatttaggtgcg
caaggtatagaatatttcacaccaatcctgaacccaccagaaagtggaattttaggtgta
ggtacatttgtacaagagcttaggttagatgaaaatgagcaggtgaaacagataatttcg
ctaccactcagcttaacctttgatcacagagtattagatggggcgccagcagcagaattc
ttaaatacgattgctcattatttagcaaaaccatatttgttattgctgtaa

DBGET integrated database retrieval system