KEGG   Vanderwaltozyma polyspora: Kpol_1028p95Help
Entry
Kpol_1028p95      CDS       T01049                                 

Definition
(RefSeq) hypothetical protein
  KO
K04565  superoxide dismutase, Cu-Zn family [EC:1.15.1.1]
Organism
vpo  Vanderwaltozyma polyspora
Pathway
vpo04146  Peroxisome
vpo04213  Longevity regulating pathway - multiple species
Brite
KEGG Orthology (KO) [BR:vpo00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    Kpol_1028p95
 09150 Organismal Systems
  09149 Aging
   04213 Longevity regulating pathway - multiple species
    Kpol_1028p95
Enzymes [BR:vpo01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     Kpol_1028p95
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Sod_Cu
Motif
Other DBs
NCBI-GeneID: 5547135
NCBI-ProteinID: XP_001646677
UniProt: A7TG62
LinkDB All DBs
AA seq 181 aa AA seqDB search
MFLDSFLDINFNYYTILIVKPSYISIAMVKASVILSGTAGVSGIVHFEQISENDPTSISY
EIKGNSPNSLRGFHIHEFGDLSNGCTSAGTHFNPFNKTHGDLLDINRHVGDMGNVQTDGS
GLAKGDTADNQIKLIGTNSVIGRAVVIHAQEDDLGKGGNEESLKTGNAGARLACGVIGIS
T
NT seq 546 nt NT seq  +upstreamnt  +downstreamnt
atgtttttggattccttccttgacataaatttcaattactataccatattaattgtgaaa
ccctcctatatctctattgcaatggttaaggcatctgtaatcttatctggcaccgctggc
gtgtcaggcattgtccactttgaacagatcagtgaaaatgatccaacttcaatctcttat
gagataaagggaaattcacccaattcccttcgtggattccatatccatgaatttggcgat
ctatctaatggttgcacttcagctggaactcatttcaaccctttcaataaaacccatggc
gatttgttggacataaatagacatgtcggtgatatgggcaatgtccaaacagatggttca
ggtttggcaaaaggtgatacggctgacaatcaaatcaaactaattggcactaactctgtc
attggcagagcagttgtcatccatgctcaggaagatgacttgggtaaaggcggtaatgaa
gagtccttgaagacaggaaatgcaggtgcgagactagcttgcggcgtaattggaatttca
acttga

DBGET integrated database retrieval system