KEGG   Vanderwaltozyma polyspora: Kpol_1031p79Help
Entry
Kpol_1031p79      CDS       T01049                                 

Definition
(RefSeq) hypothetical protein
  KO
K01077  alkaline phosphatase [EC:3.1.3.1]
Organism
vpo  Vanderwaltozyma polyspora
Pathway
vpo00730  Thiamine metabolism
vpo00790  Folate biosynthesis
vpo01100  Metabolic pathways
Module
vpo_M00126  Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:vpo00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00730 Thiamine metabolism
    Kpol_1031p79
   00790 Folate biosynthesis
    Kpol_1031p79
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:vpo04147]
    Kpol_1031p79
   00537 Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:vpo00537]
    Kpol_1031p79
Enzymes [BR:vpo01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.1  alkaline phosphatase
     Kpol_1031p79
Exosome [BR:vpo04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Kpol_1031p79
Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:vpo00537]
 Enzymes
  Kpol_1031p79
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Alk_phosphatase Metalloenzyme
Motif
Other DBs
NCBI-GeneID: 5546445
NCBI-ProteinID: XP_001646029
UniProt: A7TI09
LinkDB All DBs
AA seq 563 aa AA seqDB search
MPSQDQSSPLIYLYPLKNDGIAGHNGRKRIVFLLFSLSFLLLLASSVTIFNDNSLYSSIA
KKNLNTTKNKKNLIFFVTDGMGPASLSMARSFYQFEKNLPYYNILHLDHHLIGSSRTRSN
SSLVTDSAAGATAFSCGLKSYNGAIGVDPFKNPCGTILEAAKLSGYSTGLVVTTRLTDAT
PASFSSHVDYRVQEDQIALQQLGHYSLGPMVDLLMGGGRTHFYTGINKFGSFGSRKDNRN
LIKESIANGWSYAGSRNEFDSLKLGENVTLPFLGLFADYDIPFEIDRDPHKFPSLYEQTV
TALTALSKHTENSDKGFFIMIEGSRIDHAGHQNDPAAQVREVLGFDDAFRAAIEFANNSD
VETVIISTSDHETGGLVTSRQVTKEYPEYEWFPKVLSNSKHSGEYLKKKLVYHNFNGDLL
AKRNYIKNDIFESGLGIFDYTENDINEILGFIDDNDIQDKLNEMVSVRAEIGWTTHGHSA
VDVNIYAYANREKAWFNILSHLQGNHENIEIGKFMADYLDLDLDHVTGLIKDVDHSPPSV
IKEELESGIAMADEYHKVNYQSE
NT seq 1692 nt NT seq  +upstreamnt  +downstreamnt
atgccatctcaagatcaatcatctcctttaatctatctctatcctttgaaaaatgatggt
attgccggtcataatgggagaaaacgtatagttttcttattattctcactatcgttctta
ttattgttggcttcttcagttactatatttaacgataattcgttatattcaagtattgct
aaaaaaaatctgaatacaacaaaaaataaaaagaatttgattttcttcgtcactgatggt
atgggccctgcttctttatccatggcaaggtctttctatcaattcgaaaaaaatctacct
tattacaacattcttcatctagatcatcatttaattggttcttcaagaacaagatcaaat
agttcgttagtcaccgactccgctgctggtgcaactgctttcagttgcggtttgaagtct
tacaacggtgccataggtgtggaccctttcaaaaatccttgtggcacaattttggaagct
gcaaaactaagtggatattcaacaggcttagtggtcactacaagattaactgatgctaca
ccagcttccttcagttcccacgtagactaccgtgttcaagaggatcaaattgctttacaa
caattaggccattactccttaggtccaatggtagacctattaatgggaggtggaagaact
catttctataccggcataaataaattcggttcttttggttcccgtaaggataacagaaat
ttaattaaggaatccatcgctaatggttggtcctacgcaggttcaagaaatgaattcgat
tctttaaaacttggtgaaaacgtcactttgcctttcttgggtttgttcgctgattatgat
attcctttcgaaatcgatagagatccacataaattcccatcgttatatgaacaaactgtc
accgctttaactgctttgagtaaacatactgaaaactctgataaaggtttctttatcatg
attgaaggttcaaggatcgatcatgctggccatcaaaatgatcctgccgctcaagtaaga
gaagtcttaggttttgatgacgcatttagagcagctatagagtttgctaataattcggat
gttgaaactgtaatcatttcaacttcagaccatgaaactggtggtttagttacttcaaga
caagttacaaaagaatatcctgaatacgagtggttcccaaaagttttatcaaattcaaaa
cattcaggggaatatttaaagaagaaactagtttatcataactttaatggagatcttctt
gctaagagaaattatattaagaatgatatctttgaaagtggtttaggtatttttgactat
acagaaaatgacatcaatgaaattttaggttttatcgatgacaatgatattcaagataaa
ttgaatgaaatggtttctgttagagcagaaatcggttggaccacccatggtcattcagct
gtcgatgttaatatttacgcctatgcaaatagagaaaaagcttggtttaacattttatct
catttgcaaggtaatcacgaaaatattgaaattggaaaatttatggcagattatttagac
ctagatttagatcatgttacaggcttaattaaagatgtcgatcattctccacctagtgtt
attaaggaagaattagaatcaggcattgctatggcagatgaatatcataaagtcaattat
caatcagaatag

DBGET integrated database retrieval system