KEGG   Vanderwaltozyma polyspora: Kpol_1041p29
Entry
Kpol_1041p29      CDS       T01049                                 

Definition
(RefSeq) hypothetical protein
  KO
K12766  serine/threonine-protein kinase MDS1/RIM11 [EC:2.7.11.1]
Organism
vpo  Vanderwaltozyma polyspora
Pathway
vpo04113  Meiosis - yeast
Brite
KEGG Orthology (KO) [BR:vpo00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04113 Meiosis - yeast
    Kpol_1041p29
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:vpo01001]
    Kpol_1041p29
Enzymes [BR:vpo01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     Kpol_1041p29
Protein kinases [BR:vpo01001]
 Serine/threonine kinases: CMGC group
  GSK family [OT]
   Kpol_1041p29
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr APH Pkinase_fungal
Other DBs
NCBI-GeneID: 5545156
NCBI-ProteinID: XP_001644829
UniProt: A7TL96
LinkDB
AA seq 383 aa
MNASQDNVAIVNKQVYTGHPVDSKEDLIAISYPTTEVIGHGSFGVVFTTTIIETNELVAI
KKVLQDKRFKNRELEIMKLLKHKNIIDLKYYFYEKDSHNEIYLNLIIDYMPQSLYQRLRH
FVHRRSPMPRFEIKCYMYQLFKALNYLHDSANVCHRDIKPQNLLVNPDLLELKLCDFGSA
KQLNPSEPNVSYICSRYYRAPELIFGATNYTNQIDIWSTGCVMAELLLGQPMFPGESGID
QLVEIIKILGTPTKQEICSMNSNYMEHKFPQIKPIPLFNVFKKEDELTVNLLSDVLKYDP
MERFNSLQCLCHSYFDELRVISQNQNFDNSNNQLNLEQQNVDVNLIIKNLNLLDFNLNEE
LGHLSHDQLEAVKGKLLPNIYES
NT seq 1152 nt   +upstreamnt  +downstreamnt
atgaatgcatcccaagataacgtggctattgtaaataaacaggtctatactggccatcct
gttgactcaaaggaagacctgatcgccatctcctacccaactacagaggtaataggacat
gggtcattcggtgtcgtcttcacaacaactataatagaaacaaatgaattggtcgctatt
aaaaaagttttgcaagataaaagattcaaaaatagagaattggaaataatgaaattattg
aaacataaaaatatcatagatttaaaatactatttttatgaaaaagattctcataatgaa
atttacttaaatttaatcatagattatatgcctcaatcgttataccaaagattgagacat
ttcgtgcatcgaagatcaccaatgccaagattcgaaatcaaatgctacatgtatcagctc
ttcaaagcattgaactatttgcatgatagtgccaacgtttgtcatagagatatcaaacca
cagaatttactagtcaatccagatctgttggaactgaaactatgtgatttcggtagtgca
aaacagttaaatccaagcgaaccaaacgtttcatatatctgctcaagatattatagagct
cctgaattaatctttggtgcaactaattatacaaaccaaattgacatctggtcaactggt
tgtgtaatggcagagttattattaggtcaaccaatgtttcccggtgaaagtggtatcgat
caattagtagaaattattaaaattttaggtactcctacaaaacaagaaatttgttcgatg
aattctaattatatggaacacaagttcccacagattaaaccaatcccattgtttaacgtt
ttcaaaaaggaagatgaactaactgtaaatctattatctgacgttctaaaatatgatcca
atggaaagatttaattcattacaatgtttatgtcatagttattttgatgaattaagagta
attagtcaaaatcaaaatttcgacaacagtaataatcaattaaacttggaacaacagaat
gttgatgttaatttaataattaagaatttgaatttgctagatttcaatttaaatgaagaa
ttgggtcatctaagtcatgatcaactagaagctgtaaaaggaaaattactaccaaatatt
tatgaaagttaa

DBGET integrated database retrieval system