KEGG   Vanderwaltozyma polyspora: Kpol_2001p35Help
Entry
Kpol_2001p35      CDS       T01049                                 

Definition
(RefSeq) hypothetical protein
  KO
K11423  histone-lysine N-methyltransferase SETD2 [EC:2.1.1.43]
Organism
vpo  Vanderwaltozyma polyspora
Pathway
vpo00310  Lysine degradation
Brite
KEGG Orthology (KO) [BR:vpo00001]
 Metabolism
  Amino acid metabolism
   00310 Lysine degradation
    Kpol_2001p35
Enzymes [BR:vpo01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     Kpol_2001p35
Chromosome and associated proteins [BR:vpo03036]
 Eukaryotic Type
  Histone modification proteins
   HMTs (histone methyltransferases)
    HKMTs (histone lysine methyltransferases)
     Kpol_2001p35
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: SRI SET
Motif
Other DBs
NCBI-GeneID: 5546827
NCBI-ProteinID: XP_001646388
UniProt: A7TGR7
LinkDB All DBs
AA seq 693 aa AA seqDB search
MASSATSSPSLEASGSAVPAQRDFSNEEDKTQEALTTFINLEDCKYASKYIGNAKSSDFM
ECDCYEEFEEGINHACDENSDCINRLTLIECVNGLCDTCGDNCQNQRFQKKEYADISVFK
TKMKGYGVRANKDIEANDFIYEYKGEVIEEDEFRERLIDYDERGFKHFYFMMLQNAEFID
ATIKGSLARFCNHSCNPNAYVNKWVVAGKLKMGIFAKRDIYKGEEITFDYNVDRYGATAQ
KCYCEEPNCIGFLGGKTQTDSASLLPQSYADALGVKVSVEKKWIREMKAKGLKIDKSNGT
NINISFVESLSLAACESMDEVTKVMSVLLQIDDEYIGQKLLSRLFMITDESLLHQVIKFH
GYRCFAKLLQFYANDIGLLGQILEFLDRLPKTTKNGITSSGIDKKINDLITRDNTLYNKG
EELLEKWNSYETYNRISKKDINEISKKATDVRRIRLPPGWEIVHENGQPMYYNAQLQTKL
RHPPSGSSKTFNSRTSSRDNLHGFHKKNSNFNKRHRLDDDAYEKIKMKRIENEMKALEKA
KDEEKRLLKEKFELENQKKSELTKIIEFANKQKELEREQSIKEKEERAKRRVEKKQVSRS
SHIEHKWNKFFASVVPNLLKKYENEHNISHEHTKHCSREIVKILTSKELKKDPSRAPDEE
PTKEKRAKIRDFTTIYMDKFIQKYQDKKSTKHA
NT seq 2082 nt NT seq  +upstreamnt  +downstreamnt
atggcatcatcagctacttcctcgccttcactagaggcatcagggtctgcagttcctgca
caaagagacttctcaaatgaagaagataagacacaagaggctttgacaacttttataaat
ttggaagattgtaaatatgccagtaagtatattggtaatgccaaaagtagtgattttatg
gagtgtgactgttatgaggagtttgaagaaggaataaaccatgcctgtgacgaaaactct
gactgtatcaatagattgactttaatcgaatgtgtaaatgggttatgcgatacttgtggt
gataactgtcagaaccagagattccaaaaaaaggaatatgcagatatctcagtatttaag
actaaaatgaaaggttacggtgtacgtgccaataaagatatagaggcaaatgattttatt
tacgaatataaaggtgaagtaatcgaagaagatgaattcagggaaagactgatagattac
gatgaaagaggtttcaaacatttctattttatgatgttgcaaaatgctgaatttatcgat
gccactataaaaggttcattggctagattctgtaaccattcttgtaacccaaatgcatac
gtaaacaaatgggtcgttgcaggcaaattgaaaatggggatttttgccaaaagagatatc
tataaaggtgaagaaattactttcgattataatgtggatagatatggtgctactgcccaa
aaatgttattgtgaagaaccaaattgtataggctttttgggtggtaagactcagaccgat
tccgcttcattacttcctcaaagttacgctgatgcgttaggagtaaaagtgtctgtagaa
aagaaatggatcagagagatgaaagccaaaggtttgaaaatagataaaagtaatggaaca
aacatcaatatatcctttgtagaatcattgtcattagctgcttgtgaaagcatggacgag
gttaccaaagtaatgagtgtattattacagatcgatgatgaatacattggacaaaaacta
ctgagcagacttttcatgataacagatgagtctttgttgcaccaagtcattaaattccat
ggctacagatgttttgccaaattattacaattctatgcaaatgatattggcctattgggt
caaattttggaatttttagataggttaccaaagactacaaaaaacggtattacctcatcc
ggtatagacaaaaaaataaatgatttgataacgagagataataccttatataataaaggt
gaagagttactggaaaaatggaattcatatgaaacatataatagaatatctaaaaaggat
atcaatgaaatttctaagaaagcgacagatgtcagaagaataagattgcctccaggctgg
gaaattgtgcatgaaaatggtcaaccaatgtactataatgctcaattacagacaaagtta
cgccaccctccgtcaggctcgtccaaaacgtttaattccaggacatcttctagagataac
ttgcatggttttcacaagaaaaattctaactttaataagagacatagacttgatgatgac
gcctatgagaagattaaaatgaagagaatagaaaatgaaatgaaagctttagaaaaggct
aaggatgaagagaaacgtttgttaaaggaaaaatttgaattagaaaaccagaaaaaatct
gagttaacaaagattattgaatttgctaataagcaaaaggaattggaaagagaacaatcg
ataaaagaaaaggaagagagagcgaaaagacgtgtagaaaagaaacaagtatctcgttct
agtcatatcgaacataaatggaataagttttttgccagcgttgtgccaaatctcttgaaa
aaatatgaaaatgaacataatatcagtcacgagcatacaaaacattgttcaagagaaatt
gtaaaaatattaaccagcaaagaattgaagaaggatccttcgagagcaccagatgaagaa
cctaccaaagaaaaaagagctaaaatcagagattttacaacaatctacatggacaagttc
atacaaaaatatcaagataaaaaatctactaagcatgcataa

DBGET integrated database retrieval system