KEGG   Vanderwaltozyma polyspora: Kpol_479p6Help
Entry
Kpol_479p6        CDS       T01049                                 

Definition
(RefSeq) hypothetical protein
  KO
K11484  histone deacetylase HOS3 [EC:3.5.1.98]
Organism
vpo  Vanderwaltozyma polyspora
Brite
KEGG Orthology (KO) [BR:vpo00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:vpo03036]
    Kpol_479p6
Enzymes [BR:vpo01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.98  histone deacetylase
     Kpol_479p6
Chromosome and associated proteins [BR:vpo03036]
 Eukaryotic Type
  Histone modification proteins
   HDACs (histone deacetylases)
    Class I HDACs
     Kpol_479p6
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hist_deacetyl DFF40
Motif
Other DBs
NCBI-GeneID: 5543598
NCBI-ProteinID: XP_001643376
UniProt: A7TQB9
LinkDB All DBs
AA seq 688 aa AA seqDB search
MSSTQDPLHKFHQQFQSFVQNNPNVISAARAASQIPESAKAVVVLSPLSLQHVFLRDWVA
KSYKKTIVERPERLLASSMGISAAITMYPALFTLKSSSQRLGSLNAPHVVKIHGTKWPNE
IVKLCQKADEKLAKGEIEVPASWNAGDIYLSSRTIEALQGSIGALETGVDSIFSGPSPDH
ISNRAFVAIRPPGHHCHVDTPSGFCLLNNAHIAIEYASDTYGITHAVILDFDLHHGDGTQ
DICWKRAGFRTEAEPETTEGYDEFGKKFAEFPKVGYFSMHDINSFPTESQYATKENIRNA
STCVMNAHDVNIWNIHLSPWETEQDFDKLYQTKYRTLFAKADEFFRNAKEEMDALGKPFQ
GLVVISAGFDASEFEQTSMQRHSVNVPTHFYTMFTKDALKLSQIHCHGKVLSIMEGGYSD
KAIASGVFSHLIGLQNQNWIKEWGSEQVVKEIVRGCKPHWKPYKTKKSRDVIRIWAEEVI
KLGRSMINEFEDVLFHEKETEVNDKYGYPSLKPQRVTRSQTNELNHIKMESEHVPPSRKS
ERESRKKTEGHEAKQHVPKEAAKEVPFVEQELFSDEEDEEYIYDEELNKTFNRTVEDITI
DDISRHLETLEIVENNHDEDEDDDNGGRHKNGTKKLSNSDRRIPSSTTSRNIRVNRNSNI
LNFDDSDISMISHVGTTRKHSTRSGGRW
NT seq 2067 nt NT seq  +upstreamnt  +downstreamnt
atgtcttcaacacaagatccattgcataaattccatcagcaattccaatcgtttgtccag
aataatccaaatgtaatatcagccgcaagagctgcttcacaaattccggaatctgctaag
gcagtggtagttttatcaccattatccttacagcatgtgttcctaagagattgggttgcc
aaatcatataagaaaactattgtcgaaagaccagaacgtctattggcaagttcaatgggt
atttcagctgcaattacaatgtatcctgcgctgttcactttgaaatcgtcaagtcaaaga
ctgggttctttaaatgctcctcatgtggttaagattcatggtacaaaatggccaaatgaa
attgtaaaattatgtcaaaaagctgatgaaaaattggctaaaggtgagattgaagttcct
gcttcttggaatgccggtgatatatatttaagttctcgtactattgaggctttacagggt
tctattggcgctttagaaactggtgtggattctatctttagtgggccttctcctgaccac
atcagtaatagagcattcgtagcaatacgacctcctggtcatcattgtcatgtggacaca
ccttcagggttttgtttattgaataacgctcacattgcaattgaatatgcatctgacact
tatggtatcacccatgctgtcatcttggactttgacttgcaccatggtgatggtactcaa
gatatatgttggaaacgtgcaggtttccgtactgaagctgaacctgaaaccactgaggga
tatgatgagtttggcaagaaatttgctgaatttccaaaagttggttacttctcaatgcat
gatataaattctttccccactgaatcacaatatgctactaaggaaaatataagaaatgca
tctacttgtgttatgaatgctcatgacgtaaacatttggaatattcacttatcgccttgg
gaaactgaacaagattttgataaattataccaaaccaaatacagaactttgtttgctaaa
gctgatgaattcttcagaaatgctaaagaagaaatggacgctttaggtaaaccattccaa
ggtttagttgttataagtgcaggatttgatgcttctgagtttgagcaaacatcaatgcaa
aggcattctgttaatgttccgacgcatttttatactatgtttaccaaagatgctttaaaa
ctatcccaaattcattgccatggtaaggtgctttccatcatggaaggtggttattctgat
aaggctattgcgtctggtgtattttctcatttaattggtttgcaaaatcaaaattggata
aaagaatggggatctgaacaagttgtcaaagaaattgttcgtggctgtaaacctcattgg
aaaccatacaaaactaagaaatcgagagacgtaattagaatatgggctgaagaagtcatc
aagttaggtagatcaatgataaatgaatttgaagatgttctattccatgagaaggaaact
gaggtcaacgataaatatggttatcctagcctaaagcctcagagagttacaagatcacaa
acaaatgaactcaatcatatcaaaatggaaagtgaacatgtaccaccatctcgtaaatct
gaacgtgaatcgagaaagaagacagagggacatgaagctaagcaacatgtccccaaagaa
gcagccaaggaagtcccattcgtggaacaagaattatttagtgatgaagaagatgaagaa
tatatttatgatgaagaattgaataagacattcaatcgtacagtggaagatattacaatt
gatgatatttccaggcatttagagactttggagattgttgaaaataatcacgatgaagat
gaagatgacgataatggtggcagacataaaaacggtactaaaaaattatccaatagtgat
agaaggataccatcaagtacaacttcaagaaatatcagagttaatcgaaactcaaatata
ttgaactttgatgacagtgatatttctatgatatctcatgttggtactaccagaaaacat
tctactagaagtggaggaagatggtaa

DBGET integrated database retrieval system