KEGG   Vanderwaltozyma polyspora: Kpol_543p66Help
Entry
Kpol_543p66       CDS       T01049                                 

Definition
(RefSeq) hypothetical protein
  KO
K00234  succinate dehydrogenase (ubiquinone) flavoprotein subunit [EC:1.3.5.1]
Organism
vpo  Vanderwaltozyma polyspora
Pathway
vpo00020  Citrate cycle (TCA cycle)
vpo00190  Oxidative phosphorylation
vpo01100  Metabolic pathways
vpo01110  Biosynthesis of secondary metabolites
vpo01130  Biosynthesis of antibiotics
vpo01200  Carbon metabolism
Module
vpo_M00009  Citrate cycle (TCA cycle, Krebs cycle)
vpo_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
vpo_M00148  Succinate dehydrogenase (ubiquinone)
Brite
KEGG Orthology (KO) [BR:vpo00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Kpol_543p66
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    Kpol_543p66
Enzymes [BR:vpo01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     Kpol_543p66
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: FAD_binding_2 Succ_DH_flav_C Pyr_redox_2 GIDA Thi4 FAD_binding_3 DAO HI0933_like
Motif
Other DBs
NCBI-GeneID: 5546511
NCBI-ProteinID: XP_001646094
UniProt: A7THS0
LinkDB All DBs
AA seq 635 aa AA seqDB search
MLSLRNSLLKKSTAAEKLSLLVRKNRQFATTSNAEDVSSKYNVIDHEYDCVVVGAGGAGL
RAAFGLAEAGFKTACVSKLFPTRSHTVAAQGGINAALGNVHPDDWRWHMYDTVKGSDWLG
DQDAIHYMTREAPESIIELEHFGMPFSRLESGRIYQRAFGGQSKDFGKKGQAYRTCAVAD
RTGHAMLHTLYSEALKHDTHFFIEYFAMDLLTHNGEVRGVIAYNQEDGTIHRFKAHKTVI
ATGGYGRAYFSCTSAHTCTGDGNAMVSRAGFPLQDLEFVQFHPSGIYGSGCLITEGARGE
GGYLLNSEGERFMERYAPTAKDLASRDVVSRAITMEINAGRGVGKNKDHIFLQLSHLPQE
VLKERLPGISETASIFAGVDVTKQPIPVLPTVHYNMGGIPTKWTGEALTVDEEGNDKPIP
GLFACGEAACVSVHGANRLGANSLLDLVVFGRAVSHTISDTLQPGLPHKPLPNDIGKESL
ARLDKLRNSEGPVHTSAIRLKMQKAMQKNVSVFRTQETLDKGVEEVEAIDKTFEKDVGIA
DKSMIWNSDLVETMELQNLLTCATQTAVSAANRKESRGAHAREDYPKRNDEEWMKHTLSW
QKDTGDAVTLKYRNVVYKTLDEKECPSVPPAIRKY
NT seq 1908 nt NT seq  +upstreamnt  +downstreamnt
atgttaagtttaagaaactcattattgaagaaatcaaccgctgcagaaaaattatcatta
ttggtaaggaaaaatagacagtttgctaccacttcaaatgcagaagacgtcagctccaag
tacaatgttatcgatcatgaatatgattgtgttgttgttggtgctggtggtgctggttta
agagctgcttttggtttagctgaagctggttttaagactgcttgtgtctctaaattattc
ccaacaagatcacacacagtcgctgctcaaggtggtatcaatgctgctttgggtaatgtc
catccagatgactggagatggcatatgtacgatacagtcaagggttctgattggttaggt
gaccaagatgctatccattatatgactagagaagctccagaatctatcattgaattggaa
catttcggtatgcctttctcaagattggaaagtggtagaatctaccaaagagcattcggt
ggtcaatctaaggattttggtaaaaagggtcaagcttacagaacttgtgctgttgccgat
agaactggtcacgctatgttgcatactttatatagtgaagcattgaaacacgatactcac
ttcttcattgaatattttgctatggatttattgacacacaatggtgaagttcgtggtgtt
attgcttacaaccaagaagatggtactatccatagatttaaggctcacaaaactgttatt
gccactggtggttacgggagagcttacttctcatgtacttctgcccatacctgtaccggt
gatggtaacgctatggtttctcgtgctggtttcccattgcaagatttagaatttgtccaa
ttccatccatctggtatctatggttctggttgtttgatcacagaaggtgcccgtggtgaa
ggtggttatttattaaactctgaaggtgaaagatttatggaaagatatgctccaactgcc
aaagatttagcatccagagatgttgtttctagagctattacaatggaaatcaatgctggt
agaggtgtaggtaaaaataaggatcacattttcttgcaattgagccatttgccacaagaa
gtcttgaaggaaagattaccaggtatctccgaaaccgcttccatttttgcaggtgttgat
gtcaccaaacaaccaattccagttttgccaacagttcattacaatatgggtggtatccca
actaaatggacaggtgaagccttaactgtcgatgaagaaggtaacgataaacctattcca
ggtttgtttgcctgtggtgaagctgcctgtgtttctgtccatggtgctaacagattgggt
gccaactctttgctagatttagttgtcttcggtagagctgtttctcacaccatttctgat
actttacaaccaggtctacctcacaaaccattgccaaacgatattggcaaagaatcttta
gctagattagacaagttgagaaacagtgaaggtccagttcatacttctgctattagatta
aagatgcaaaaggctatgcaaaagaacgtttcagtctttagaactcaagaaaccttagat
aagggtgtagaagaagttgaagctatagataagactttcgaaaaggatgtcggtattgct
gacaaatctatgatctggaactctgatttggttgaaaccatggaattgcaaaacttgttg
acttgtgctactcaaaccgccgtttctgctgctaacagaaaggaatctcgtggtgctcac
gctagagaagattatccaaagagaaacgatgaagaatggatgaagcacactttatcatgg
caaaaggacactggtgatgctgttaccttgaaatacagaaacgttgtttacaagactttg
gatgaaaaagaatgtccatccgttccaccagccatcagaaagtattag

DBGET integrated database retrieval system