KEGG   Veillonella parvula: Vpar_0223
Entry
Vpar_0223         CDS       T01130                                 

Definition
(GenBank) nitrate reductase, beta subunit
  KO
K00371  nitrate reductase / nitrite oxidoreductase, beta subunit [EC:1.7.5.1 1.7.99.-]
Organism
vpr  Veillonella parvula
Pathway
vpr00910  Nitrogen metabolism
vpr01100  Metabolic pathways
vpr01120  Microbial metabolism in diverse environments
vpr02020  Two-component system
Brite
KEGG Orthology (KO) [BR:vpr00001]
 09100 Metabolism
  09102 Energy metabolism
   00910 Nitrogen metabolism
    Vpar_0223
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    Vpar_0223
Enzymes [BR:vpr01000]
 1. Oxidoreductases
  1.7  Acting on other nitrogenous compounds as donors
   1.7.5  With a quinone or similar compound as acceptor
    1.7.5.1  nitrate reductase (quinone)
     Vpar_0223
   1.7.99  With unknown physiological acceptors
    1.7.99.-  
     Vpar_0223
SSDB
Motif
Pfam: Fer4_11 Nitr_red_bet_C Fer4_10 Fer4_7 Fer4_9 Fer4_6 Fer4_21 Fer4_2 Fer4_13
Other DBs
NCBI-ProteinID: ACZ23910
UniProt: D1BQU7
LinkDB
Position
301751..303184
AA seq 477 aa
MKIKAQVSMVLNLDKCLGCHTCSITCKNTWTNREGAEYMYFNNVETRPGVGYPRNWENQE
KWKGGWTLDKSGNLALSTGSKGSRLMKLFYHPEQPEITDYFEPWTYDYETLIHTGRKNNQ
PVARPRSLLTKQKMEVTWGPNWDDDLAGGHHAREDVNLAKMGDDIVFDYEEVFMRYLPRL
CNHCLNPACVAACPSGAIYKRDEDGVVLVSQDVCRGWRHCVPSCPYKKIFYNWETNKAEK
CVFCYPRLENGLPQICAETCVGRMRYVGVVLYDMDKVQEMAATKDEQDIYQNTVDLILDP
NDPEVIKAAREAGISEAFLKAAKKSPVYKLVKEWGVALPLHPEYRTLPMVWYVPPLSPIL
QRVTSDVYLPDAHEMRVPVQYLANMFTAGNTDILARVLQRILDMREYMRRRETGDEAIAH
EVDLTEEQMYAMYKLLALSKYNDRFVIPSDVNVSREGRLEMQHNRGFACPTGGCHNG
NT seq 1434 nt   +upstreamnt  +downstreamnt
ttgaagattaaagctcaagtatccatggtcctaaatttggacaagtgtttaggctgtcat
acatgctctattacttgtaaaaatacatggacgaaccgcgaaggcgcggaatatatgtac
tttaataacgtggaaacccgccctggcgtgggttacccacgtaattgggaaaaccaagag
aaatggaagggtggctggactctcgataaaagcggtaatttggcgctttccacaggctct
aaaggctctcgattgatgaagttgttctatcatccagaacaaccagaaattacggattac
tttgaaccttggacatacgattatgaaacattaattcataccggtcgtaaaaataatcaa
cctgtagcacgtcctcgttctttgttaacaaagcaaaaaatggaagtaacatggggccct
aactgggatgatgatttggctggtggtcatcatgcacgggaagatgtgaacttggctaag
atgggtgatgatatcgtatttgactacgaagaagtattcatgcgttatttaccacgtctt
tgtaaccactgtttgaatcctgcatgtgtagcagcatgtccatccggtgctatctacaag
cgtgatgaagatggtgttgtacttgtttctcaagatgtatgccgcggttggagacattgc
gttccatcttgcccatacaaaaaaatcttctataactgggaaacgaataaagctgaaaaa
tgtgtattctgttaccctcgtttggaaaatggtctgcctcaaatatgcgctgaaacatgt
gtaggtcgtatgcgctatgttggtgtagtcttatacgatatggacaaagttcaagaaatg
gcagctacgaaggatgaacaagacatctaccaaaatacagtagatttaatcttggaccct
aatgatccagaggttattaaagccgctcgcgaagcaggtatctctgaagcattcttgaaa
gcagctaaaaaatctcctgtttacaagcttgtaaaagaatggggcgttgcattgccattg
catccagagtatcgcacattgccaatggtttggtatgtgccaccgctcagcccaatttta
caacgtgttacatctgatgtatacttgccagatgcacatgaaatgcgcgtgcctgtacaa
tacttagctaatatgtttactgctggtaatacagatattttagctcgtgtattacaacgc
attctcgatatgcgtgaatacatgcgtcgccgtgaaacaggtgatgaagcaatcgctcat
gaagtagatcttacagaagagcaaatgtatgctatgtacaaattgttagccttgtctaaa
tataatgatcgttttgttatcccatctgatgttaatgtatctcgcgaaggtcgcttagaa
atgcaacacaatcgtggttttgcatgcccgacagggggttgccataatggatga

DBGET integrated database retrieval system