KEGG   Veillonella parvula: Vpar_0507
Entry
Vpar_0507         CDS       T01130                                 

Definition
(GenBank) putative transcriptional acitvator, Baf family
  KO
K03525  type III pantothenate kinase [EC:2.7.1.33]
Organism
vpr  Veillonella parvula
Pathway
vpr00770  Pantothenate and CoA biosynthesis
vpr01100  Metabolic pathways
vpr01240  Biosynthesis of cofactors
Module
vpr_M00120  Coenzyme A biosynthesis, pantothenate => CoA
Brite
KEGG Orthology (KO) [BR:vpr00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00770 Pantothenate and CoA biosynthesis
    Vpar_0507
Enzymes [BR:vpr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.33  pantothenate kinase
     Vpar_0507
SSDB
Motif
Pfam: Pan_kinase
Other DBs
NCBI-ProteinID: ACZ24190
UniProt: D1BLD3
LinkDB
Position
619258..620025
AA seq 255 aa
MLLVIDVGNTNIVLGVYDKTELVGHWRISTDRVRTTDEYGMLMMNLFFHDRKVDVKDINA
IIISSVVPPLMPTLERVCLRYFNVNPLIVGPGTKTGIAIKYDNPREVGADRIVNAVAAHE
LYKGDLIIIDFGTATTYCAVQGNGDYVGGVITPGVTISAEALFQRAAKLPRIDVRDPGQV
ICRNTVSSMQSGMFYGYVGQVEGLVSRMKAEMGDHVTVVATGGLAQLISSATDCIDHVEP
MLTLEGLRLIYERNK
NT seq 768 nt   +upstreamnt  +downstreamnt
atgttattagtaattgatgtgggaaacaccaatattgttctcggtgtatacgacaagaca
gaacttgtggggcactggcgtatttccacagatcgggtccgtaccaccgatgaatatggc
atgctgatgatgaacttattcttccacgatcgtaaggttgatgtaaaagatattaatgct
atcattatttcctcggttgtaccaccattgatgcctacattagagcgcgtgtgtttgcgc
tactttaatgtaaatcctcttattgtaggtccaggcactaaaactggcatcgctattaag
tatgataatcctcgtgaagtaggggctgaccgtatcgtaaatgccgtagcggcacatgaa
ctttataaaggtgatttaattatcatcgactttggtaccgctactacttattgtgcggta
caaggtaatggcgactatgtgggcggagttattactccaggggtaacaatttctgcagaa
gctttattccaacgggcggccaaattacctcgtatcgatgtgagagacccaggacaagtc
atttgccgaaatacggtgtcttctatgcaatctggtatgttctacggttatgtaggtcaa
gtagagggactcgtgtctcgtatgaaagcggaaatgggagatcatgtaactgtagtggct
acaggtggtttggcacagcttattagcagtgctacagattgcattgaccatgtagaacca
atgcttacattggaaggcttacgccttatttacgaaagaaataaataa

DBGET integrated database retrieval system