KEGG   Veillonella parvula: Vpar_0531
Entry
Vpar_0531         CDS       T01130                                 

Definition
(GenBank) UDP-3-O-(3-hydroxymyristoyl) glucosamine N-acyltransferase
  KO
K02536  UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase [EC:2.3.1.191]
Organism
vpr  Veillonella parvula
Pathway
vpr00540  Lipopolysaccharide biosynthesis
vpr01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:vpr00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00540 Lipopolysaccharide biosynthesis
    Vpar_0531
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01005 Lipopolysaccharide biosynthesis proteins [BR:vpr01005]
    Vpar_0531
Enzymes [BR:vpr01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.191  UDP-3-O-(3-hydroxymyristoyl)glucosamine N-acyltransferase
     Vpar_0531
Lipopolysaccharide biosynthesis proteins [BR:vpr01005]
 Lipid A
  Vpar_0531
SSDB
Motif
Pfam: Hexapep LpxD Hexapep_2
Other DBs
NCBI-ProteinID: ACZ24214
UniProt: D1BLF7
LinkDB
Position
650931..651962
AA seq 343 aa
MEKTLQELANLVGGQLIGDESIVITETRSFEQAVKQSITFAIGEYVEHIALCQAGAVIVE
SEVKNAPMAQIVVDNAKAAFAQVLEVFHPPVVVPREVHSTAIIGKNVTLGKNVAIGAYCV
INDNAVIGDNVTIRPYVYIGHNVRIGEDSDIYAGAIVHENCILGKRVVLRAKAVIGGEGF
GFATENGIHTHIPQVGNVILEDDVEIGSCTTVDNATMGSTLVRRGTKIDNLVHLGHNVEI
GEDCFLIAQVGIAGSTKCGNHVIFAGQTGCTGHITIGDNVQFAGKTGITGNVPSNSVMAG
YPMRPHKEWLKLAAYENRLPEMVKTVKQLQKEIDALKAQLKES
NT seq 1032 nt   +upstreamnt  +downstreamnt
ttggaaaaaactttacaggaactcgcaaatttagtaggcggtcaacttataggggatgag
tctattgtcattactgagacacgtagctttgagcaagcagtaaaacaatccataactttt
gcaataggtgaatatgttgaacatattgcattatgccaagcgggtgctgttatcgttgaa
tcggaagtaaagaatgcaccgatggcacaaatcgtagttgataatgcaaaagctgcattc
gcccaagtgctagaagtattccatccacctgttgtagttccccgtgaagtgcatagtaca
gctattattggcaagaatgttacacttggtaaaaatgtagctattggtgcctattgtgtt
attaatgataatgctgttatcggtgataatgtaacaattcgaccttatgtatatattggt
cataatgtacgaattggggaagattctgatatctatgcaggtgctatcgtacatgagaac
tgtattttgggtaaacgcgttgtattgcgtgctaaagcagttatcggtggtgaaggtttt
ggctttgccacagaaaatggtattcatacgcatattcctcaagtaggcaatgttattctt
gaagatgatgtagaaattggttcttgcactactgttgataatgctacaatgggatctacc
ttggtacgtcgcggtacaaaaattgacaatcttgttcaccttggccacaatgttgagatt
ggagaagattgtttcttgattgcacaggttgggattgcaggtagtacaaaatgtggtaac
catgtaatctttgcaggacaaacaggctgtactggtcatattacaattggagataatgta
caatttgcaggtaaaacaggaattactggcaatgtaccatctaattctgttatggctggg
tatccaatgagacctcataaagagtggttaaaattggctgcttacgagaatcgtttgcca
gaaatggtgaaaactgtaaaacaattacaaaaagaaattgacgctttgaaagcacagctt
aaggagagctaa

DBGET integrated database retrieval system