KEGG   Veillonella parvula: Vpar_0533
Entry
Vpar_0533         CDS       T01130                                 

Definition
(GenBank) UDP-3-0-acyl N-acetylglucosamine deacetylase
  KO
K02535  UDP-3-O-[3-hydroxymyristoyl] N-acetylglucosamine deacetylase [EC:3.5.1.108]
Organism
vpr  Veillonella parvula
Pathway
vpr00540  Lipopolysaccharide biosynthesis
vpr01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:vpr00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00540 Lipopolysaccharide biosynthesis
    Vpar_0533
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01005 Lipopolysaccharide biosynthesis proteins [BR:vpr01005]
    Vpar_0533
Enzymes [BR:vpr01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.108  UDP-3-O-acyl-N-acetylglucosamine deacetylase
     Vpar_0533
Lipopolysaccharide biosynthesis proteins [BR:vpr01005]
 Lipid A
  Vpar_0533
SSDB
Motif
Pfam: LpxC
Other DBs
NCBI-ProteinID: ACZ24216
UniProt: D1BLF9
LinkDB
Position
653135..653974
AA seq 279 aa
MSKPQQTIKKAVSYQGIGLHSGEPVHMVFKPAPEDTGIVFVRTDIEGHPSVRAHIDNVTN
TMRATTLENGEAKVFTVEHVMAAFSAMNIDNCYIEMDSPEPPVGDGSSAIFVNLIEKAGI
EEQIALRHIYKVTRSHAVYDGDRFIVILPYDGYRMTFTSINSHPLLGTQQCDFEVSPEYF
KAHIGSARTIGFMKELEQLQAMGLAKGGSLDNALVYDDEKCLSIPRFEDELVRHKALDVI
GDLFLLGPIEGHVIALKSSHELNSRLARSIMEEIRETQP
NT seq 840 nt   +upstreamnt  +downstreamnt
atgagtaagccacaacaaacaataaaaaaggctgtttcatatcaagggattggccttcat
agcggtgaaccagtacatatggtttttaagcctgcacctgaagatacaggaattgtgttt
gtccgcacggacattgaagggcatccttctgtgcgagcacacattgataatgtgacgaac
actatgcgcgctaccacgttggaaaatggtgaagcaaaggtatttactgttgaacatgtg
atggcagcgttcagtgctatgaatattgataactgttatattgaaatggattctccagaa
cctcctgtaggtgatggtagtagtgctatttttgtcaatcttattgaaaaggctggcatt
gaagaacaaatagcgttgcgtcatatatacaaagtgactcgatctcatgctgtttatgat
ggggatcgttttattgtgattttgccatatgatggctatcgcatgacttttacatcaatt
aacagccatccgttgcttggtacgcaacaatgtgattttgaagtatcgcctgagtatttc
aaagcccacattggatcggctaggactatcggatttatgaaggaattggaacaattacag
gccatggggcttgcaaaaggcggtagcctagataatgcattagtctatgatgatgagaaa
tgtctatctataccacgctttgaggatgaattagttcgccataaagcattagatgttata
ggggatttattcttgttaggaccgattgaaggccatgtaattgctttgaaatcgagtcat
gaattaaattcaagattggctcgcagtataatggaagaaataagggagacacagccatga

DBGET integrated database retrieval system