KEGG   Veillonella parvula: Vpar_0540
Entry
Vpar_0540         CDS       T01130                                 

Definition
(GenBank) Three-deoxy-D-manno-octulosonic-acid transferase domain protein
  KO
K02527  3-deoxy-D-manno-octulosonic-acid transferase [EC:2.4.99.12 2.4.99.13 2.4.99.14 2.4.99.15]
Organism
vpr  Veillonella parvula
Pathway
vpr00540  Lipopolysaccharide biosynthesis
vpr01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:vpr00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00540 Lipopolysaccharide biosynthesis
    Vpar_0540
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01005 Lipopolysaccharide biosynthesis proteins [BR:vpr01005]
    Vpar_0540
Enzymes [BR:vpr01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.99  Transferring other glycosyl groups
    2.4.99.12  lipid IVA 3-deoxy-D-manno-octulosonic acid transferase
     Vpar_0540
    2.4.99.13  (Kdo)-lipid IVA 3-deoxy-D-manno-octulosonic acid transferase
     Vpar_0540
    2.4.99.14  (Kdo)2-lipid IVA (2-8) 3-deoxy-D-manno-octulosonic acid transferase
     Vpar_0540
    2.4.99.15  (Kdo)3-lipid IVA (2-4) 3-deoxy-D-manno-octulosonic acid transferase
     Vpar_0540
Lipopolysaccharide biosynthesis proteins [BR:vpr01005]
 Lipid A
  Vpar_0540
SSDB
Motif
Pfam: Glycos_transf_N Glycos_transf_1
Other DBs
NCBI-ProteinID: ACZ24223
UniProt: D1BLG6
LinkDB
Position
659255..660559
AA seq 434 aa
MYWIYNVLLIFYWIGLIPVILYRLAFEDGFYERIKQSAGYMPASLLKKIEGRRAIWIHAA
SVGEIVATSPLVKEVKKEFPEAVVVVSVVTATGHAMAHRIIPEAEGIIFFPLDLPYLTRK
ILHIIKPITILLVETEIWPNFLRIAESENIPVMMVNGRISDRSMKRYKYISAFTREMLRS
IERFCMQSKFDAAYIESLGAHTPDITVTGNMKYDQTYATVSYEEKQALLDEFGFGNNHPI
IIAGSTHKGEEEAIFETFKQVLKEYPQARLLIAPREIYRGHDVQNIAKRYELSAICRSDM
KEPVHEGIPVVVLDTIGELGRLYSLGDIIFVGGSLVKTGGHNILEPAAHGKPILVGPHMF
NFKEIFALLNSRNACEQVKNGKELTAMVLRLCKDRDLAKKMGQNCLDIIKENRGATRRNT
QELRLLFEKHQIIP
NT seq 1305 nt   +upstreamnt  +downstreamnt
atgtactggatatataacgtattgctcatattttattggataggcttgattccggttatt
ttataccgacttgcctttgaagatggcttttatgagcgtatcaaacaaagtgcaggctat
atgcccgcttcgctattaaagaaaattgaagggcgtcgtgctatttggattcacgccgct
tccgtaggggaaattgtggctaccagtccattggtaaaagaggttaaaaaggaatttcct
gaagctgttgtggttgtgtcagtagttactgctactggtcatgctatggctcatcgtatc
attcctgaagcagaaggaattatattctttccccttgatttgccgtatttaactcgtaaa
attttacatattattaagccgattactattttactcgtagaaactgaaatttggccaaac
ttcttgcgtatcgccgaatcggaaaacattccagttatgatggttaatggacgcatttca
gatcgcagtatgaaacgttataagtatatcagtgcttttacgcgtgaaatgttacgctct
attgagcgtttctgcatgcagtccaaatttgatgcggcgtatattgaaagtttaggtgct
catacacctgatattaccgtaacaggtaatatgaaatacgatcaaacatatgccaccgta
tcatatgaagaaaaacaagctcttctcgatgaatttggctttggaaataatcatcctatc
attattgcaggtagtactcacaaaggtgaagaagaggctatttttgaaaccttcaagcaa
gtattgaaagagtatccacaagctcgtttattgattgcgcctcgtgaaatttatcgcggt
catgatgtgcaaaatattgcaaagcgttatgaattgagtgctatttgtcgtagcgatatg
aaggagcctgttcatgaaggtattcccgttgtcgttttagataccattggtgaacttggc
cgactgtatagcttaggcgatattatctttgttggtggttcccttgttaaaactggaggc
cataatattttggaaccagctgcacatggtaagccaattttggttgggcctcatatgttt
aactttaaagaaattttcgccttattaaactctcgaaatgcttgtgagcaagtgaagaat
ggaaaagagttaaccgctatggtcttgcgtttatgtaaggatagagacttggctaaaaag
atggggcaaaactgcctggatatcattaaagaaaatcgtggtgctacgcggcgtaataca
caagagttacgtttgctatttgagaaacatcaaattattccgtag

DBGET integrated database retrieval system