KEGG   Veillonella parvula: Vpar_0541
Entry
Vpar_0541         CDS       T01130                                 

Definition
(GenBank) tetraacyldisaccharide 4'-kinase
  KO
K00912  tetraacyldisaccharide 4'-kinase [EC:2.7.1.130]
Organism
vpr  Veillonella parvula
Pathway
vpr00540  Lipopolysaccharide biosynthesis
vpr01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:vpr00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00540 Lipopolysaccharide biosynthesis
    Vpar_0541
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01005 Lipopolysaccharide biosynthesis proteins [BR:vpr01005]
    Vpar_0541
Enzymes [BR:vpr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.130  tetraacyldisaccharide 4'-kinase
     Vpar_0541
Lipopolysaccharide biosynthesis proteins [BR:vpr01005]
 Lipid A
  Vpar_0541
SSDB
Motif
Pfam: LpxK
Other DBs
NCBI-ProteinID: ACZ24224
UniProt: D1BLG7
LinkDB
Position
660614..661726
AA seq 370 aa
MSGEALFKSIVSGEDQSVLGDIARSSLGLLSKGYEKAVSIRNARFDEGKGVTKVTVPVIS
VGNITAGGTGKTPMVRFICDVLTQKGLHPTVLSRGYRAEDNNKNIIISKDGTMLVEPSIS
GDEAWLLAKVLQKSNVIIGRERSKSAEIAINELGADCLIMDDGFQHRALARDIDIVLIDA
SNPFGYEHVLPRGLLREPLSGLQRADIIVLTKVDQVAPGIVSGIRKRLTQMIPNIPVYET
THKPQFMYTLDEWANGSVGASVDAYKEQRIMAVSGIGNPQSFTQTLTDVGYNVVHTLPFG
DHHDFSNDDVVEIWKQAFAHQADAICITEKDAVKLSQLHAIEDLKIPILVLSIGIEFVSG
KQEFIENLEI
NT seq 1113 nt   +upstreamnt  +downstreamnt
atgagtggggaagcattattcaaatccatcgttagtggtgaagatcaatccgtattaggt
gatatagctcgctccagtttaggccttttgagtaaaggttatgagaaagctgtatcaata
cgcaatgctcgatttgatgagggtaaaggcgttacgaaagttacagtgcctgtaatcagc
gttggcaacattacggctggtggtactggaaaaacaccgatggtgcgatttatttgtgat
gtgcttactcagaagggccttcatcctactgttcttagtcgtggataccgtgcagaagat
aataacaaaaatattattatttctaaagatggaacaatgcttgtagagccatctatcagt
ggtgatgaggcttggttactggctaaggttttacaaaaatctaatgtaatcattggacgt
gaacgttccaaatctgcagaaatcgctattaatgagctaggtgccgattgtcttattatg
gatgatggctttcaacatcgtgcactagcaagagatattgatattgtactaatcgatgca
tccaatccgtttggctatgaacatgtattgccacggggactattacgtgaaccccttagt
ggtttacagcgtgcggatattatcgttcttactaaggttgatcaagtagcaccaggtatt
gtatccggcattcgaaagcgattaactcagatgattcccaatatacctgtctatgaaaca
acacataagccgcaatttatgtacaccttagatgagtgggctaatggttctgttggggct
tctgtagatgcttacaaggaacaacgcattatggctgtgagtggaattggaaaccctcaa
tcctttacacaaacgttaactgatgtagggtataacgttgttcataccttgccatttgga
gatcatcatgacttttcaaatgatgatgtagttgagatttggaaacaagcatttgctcat
caagctgatgctatttgcattacagaaaaggatgcagttaagttaagtcagttgcatgca
attgaagacttgaaaataccgattctggtgctatctatagggattgaatttgtttctgga
aaacaagaattcatagaaaatttagagatttag

DBGET integrated database retrieval system