KEGG   Veillonella parvula: Vpar_0542
Entry
Vpar_0542         CDS       T01130                                 

Definition
(GenBank) 3-deoxy-D-manno-octulosonatecytidylyltransferase
  KO
K00979  3-deoxy-manno-octulosonate cytidylyltransferase (CMP-KDO synthetase) [EC:2.7.7.38]
Organism
vpr  Veillonella parvula
Pathway
vpr00540  Lipopolysaccharide biosynthesis
vpr01100  Metabolic pathways
Module
vpr_M00063  CMP-KDO biosynthesis
Brite
KEGG Orthology (KO) [BR:vpr00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00540 Lipopolysaccharide biosynthesis
    Vpar_0542
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01005 Lipopolysaccharide biosynthesis proteins [BR:vpr01005]
    Vpar_0542
Enzymes [BR:vpr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.38  3-deoxy-manno-octulosonate cytidylyltransferase
     Vpar_0542
Lipopolysaccharide biosynthesis proteins [BR:vpr01005]
 Lipid A
  Vpar_0542
SSDB
Motif
Pfam: CTP_transf_3 NTP_transf_3
Other DBs
NCBI-ProteinID: ACZ24225
UniProt: D1BLG8
LinkDB
Position
661771..662502
AA seq 243 aa
MKFGCVIPARYGSTRLPGKPLADIAGKPMIERVYARVSQATKTVCTIVATDDNRVYSAVQ
QFGGTVMMTDPNHPTGTDRLAEVASHYTDLDVVINVQGDEPMIDPNLIDDLARLFEEDPN
LQMATVATPLLEEEYEEPSAVKVILNNRNDAMYFSRSLIPYPRHDFVRPPLKHIGIYAYR
REFLLNYAKMEPTPAERTESLEQLRALENGYTIRVILTNKRFIGVDTPEDLARVNAIYEQ
EEK
NT seq 732 nt   +upstreamnt  +downstreamnt
gtgaagtttggatgtgttattcctgcgcgttatggttctacaagattaccgggcaaacca
ttagctgatattgcaggtaaacctatgattgaacgggtttatgcaagggtatcacaagct
acaaagacagtatgtacaattgtagccactgatgataaccgcgtatattctgcagtacaa
cagtttgggggaactgttatgatgacagatcctaatcaccctacagggacggatcgatta
gcagaggttgcgagtcattatacagacttggatgttgttatcaatgtccaaggtgatgaa
ccgatgattgatccaaatcttattgatgacttggcacgtctatttgaggaagatccaaac
ttgcagatggccacagtagctactcctttattagaggaagagtacgaggagccatcagcg
gtaaaggtcattttaaataatcgtaatgatgcgatgtatttttctagatctttaatccca
tatcctcgccatgattttgtgcgtccgccactaaaacatattggcatctatgcatatcgt
agagagtttttattaaactacgctaagatggagccaactccggcggagcgaacagaatct
ctagaacaattacgtgctctagagaacggttatacaattcgtgttattttgacaaataaa
cgatttatcggtgttgatacacctgaagacttagctcgtgttaatgcaatttacgagcaa
gaggagaaataa

DBGET integrated database retrieval system