KEGG   Veillonella parvula: Vpar_0779
Entry
Vpar_0779         CDS       T01130                                 

Definition
(GenBank) dephospho-CoA kinase
  KO
K00859  dephospho-CoA kinase [EC:2.7.1.24]
Organism
vpr  Veillonella parvula
Pathway
vpr00770  Pantothenate and CoA biosynthesis
vpr01100  Metabolic pathways
vpr01240  Biosynthesis of cofactors
Module
vpr_M00120  Coenzyme A biosynthesis, pantothenate => CoA
Brite
KEGG Orthology (KO) [BR:vpr00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00770 Pantothenate and CoA biosynthesis
    Vpar_0779
Enzymes [BR:vpr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.24  dephospho-CoA kinase
     Vpar_0779
SSDB
Motif
Pfam: CoaE AAA_28 AAA_17
Other DBs
NCBI-ProteinID: ACZ24460
UniProt: D1BM53
LinkDB
Position
921781..922383
AA seq 200 aa
MFKIGLTGGIASGKSTVLTYFKDKGIPYIDADIVAREVVEPGTKGLEAIVAAFGTDVLHD
DRTLNREALGAIIFHNEKKRQQLNGCLKEHIQNRIMELTAHYEALHTPVLLYDIPLLIEG
EWYTMMDEVWLVYVNESTQIERLMNRNGFTKEDALARIKSQMRLDDKRTYADVIIDNNGT
TLDLKKQLDTIWNERIESVL
NT seq 603 nt   +upstreamnt  +downstreamnt
atgtttaaaattggcttaactggtggcattgcatctggcaaaagtacagttcttacatat
tttaaggataaaggtataccgtatatcgatgctgatattgtggctcgtgaagttgtagag
cctggtacaaaagggctagaagcaattgtagctgcatttggaaccgatgtattgcacgat
gataggacattaaaccgagaagcattaggggctattatctttcacaatgaaaaaaaacgc
caacaactgaatggttgtttaaaagagcatattcaaaatcgaatcatggagctcacagct
cattatgaggcactgcatacaccagttttactatatgacattcctttacttatcgaagga
gagtggtataccatgatggacgaggtgtggctcgtatatgtgaatgagtcaactcaaatt
gagcgcttaatgaaccgcaatggatttaccaaagaggatgcattggctcgtattaagagt
caaatgcgtcttgatgacaaacggacttatgcggatgtaatcattgataataatggtaca
actttggatttaaagaaacaattagataccatctggaatgagcgtattgaatcagttcta
taa

DBGET integrated database retrieval system