KEGG   Veillonella parvula: Vpar_0836
Entry
Vpar_0836         CDS       T01130                                 

Definition
(GenBank) pantetheine-phosphate adenylyltransferase
  KO
K00954  pantetheine-phosphate adenylyltransferase [EC:2.7.7.3]
Organism
vpr  Veillonella parvula
Pathway
vpr00770  Pantothenate and CoA biosynthesis
vpr01100  Metabolic pathways
vpr01240  Biosynthesis of cofactors
Module
vpr_M00120  Coenzyme A biosynthesis, pantothenate => CoA
Brite
KEGG Orthology (KO) [BR:vpr00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00770 Pantothenate and CoA biosynthesis
    Vpar_0836
Enzymes [BR:vpr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.3  pantetheine-phosphate adenylyltransferase
     Vpar_0836
SSDB
Motif
Pfam: CTP_transf_like Citrate_ly_lig
Other DBs
NCBI-ProteinID: ACZ24517
UniProt: D1BMB0
LinkDB
Position
978742..979233
AA seq 163 aa
MRIGVCPGSFDPVTNGHVDIFERGSRLVDKLIIAVSSNPNKNSLFSMEERVEMIRNSVKH
IPNVEIDCTGGLLNEYVKSKNATIIIRGLRALSDFEYEFQRALFAKYLDDDIETVFIMTN
NKYSFVSSTGIRELAKFGGKLDGLVPDDVKEKLEERFNTVHNK
NT seq 492 nt   +upstreamnt  +downstreamnt
gtgcgtataggtgtatgtccgggtagttttgacccagttactaatggacatgttgatatt
tttgaacggggcagccgattggttgataaattaatcattgctgtcagctcaaatccgaat
aaaaattccttattttctatggaagaacgggttgagatgattcgaaattctgtcaaacat
attcctaatgttgaaattgattgtacaggtggcttgctcaatgagtatgttaaatccaag
aatgctactattattattcgaggattacgtgcattgagcgactttgaatatgaatttcag
cgcgcattatttgcaaaatatttggatgatgacattgaaacagtatttattatgacaaat
aacaaatactcttttgtcagctccacgggtattcgtgaactagctaaatttggtggtaag
ctagatggtcttgttccggatgatgttaaggaaaaacttgaagaacgctttaatacggtc
cataataaatag

DBGET integrated database retrieval system