KEGG   Veillonella parvula: Vpar_0843
Entry
Vpar_0843         CDS       T01130                                 

Definition
(GenBank) phosphopantothenoylcysteine decarboxylase/phosphopantothenate/cysteine ligase
  KO
K13038  phosphopantothenoylcysteine decarboxylase / phosphopantothenate---cysteine ligase [EC:4.1.1.36 6.3.2.5]
Organism
vpr  Veillonella parvula
Pathway
vpr00770  Pantothenate and CoA biosynthesis
vpr01100  Metabolic pathways
vpr01240  Biosynthesis of cofactors
Module
vpr_M00120  Coenzyme A biosynthesis, pantothenate => CoA
Brite
KEGG Orthology (KO) [BR:vpr00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00770 Pantothenate and CoA biosynthesis
    Vpar_0843
Enzymes [BR:vpr01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.36  phosphopantothenoylcysteine decarboxylase
     Vpar_0843
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.5  phosphopantothenate---cysteine ligase (CTP)
     Vpar_0843
SSDB
Motif
Pfam: DFP Flavoprotein NAD_binding_10 Cas_GSU0053
Other DBs
NCBI-ProteinID: ACZ24524
UniProt: D1BMB7
LinkDB
Position
983795..985000
AA seq 401 aa
MRGKHIIVAVSAGIAAYKAIEVVSRLRKKGAEVKVVMTQNATHIASPLTFGEISGHPVAL
DMFEQVHQWDVEHIALATWADAYVVVPATANVIGKIYAGIADDMLTTTIMATTAPKYLCP
AMNTEMYNNPITQRNLEGLRSLGYHIMDPAEGWLACGITGVGRLPEPEAIVDWLEAKMCS
TNELEGTTILVTAGGTQESIDPVRYIGNRSSGKMGYAIAEQAARMGAKVILVSAPTSLPI
PNGVDFISVDSAVSMQEAVEARFNDVNVVIMAAAVSDFRVLHKAEQKIKKMESMTIELVK
NPDILQGLGSKKSHQILVGFAAETEHVIKYGQDKVAKKNLDMLVANDVSKSNAGFNVDTN
EGYFLYPDKEPKEMPNMKKSDLARHILIEVIDLVANKADIN
NT seq 1206 nt   +upstreamnt  +downstreamnt
atgcgcggaaaacatatcattgtcgcagtatctgcaggtattgcagcgtataaggcaatt
gaagtggtaagcagacttcgtaaaaaaggtgctgaagtaaaggttgtaatgacacaaaat
gcaacgcatattgcgtcacctttaacatttggtgaaattagtggacatcctgtagcttta
gacatgtttgaacaagttcatcagtgggatgtagaacatattgcactggccacttgggca
gatgcatatgtagttgtgcctgcaacagcaaatgtgatcggaaaaatttatgcaggcatt
gctgatgatatgttaactacaacaattatggccaccacagcacctaagtacctttgtcct
gctatgaatacagaaatgtataataaccctattactcaacgcaatttagaaggattacgt
tctttgggctaccatattatggaccctgcagaaggttggttagcttgtggcatcactggt
gtaggacgtttaccggagcccgaagcaattgtggattggctagaagctaaaatgtgcagc
accaatgagcttgaaggtactactatacttgttacagctggcggaacacaggagagtatt
gatcctgttcggtatattggaaatcgttctagcggtaagatggggtatgccattgcagaa
caggctgcacgcatgggggctaaggtgatattagtaagtgctcccacatccttgcctata
ccaaatggcgtagactttatttctgtagattccgcggtatctatgcaggaggctgttgaa
gctcgttttaatgatgttaatgtagttattatggctgccgctgtttctgactttagagtc
cttcataaagcagagcaaaaaataaaaaaaatggagtctatgaccatagaacttgtaaaa
aatccagatattctacaagggttgggctctaaaaaaagtcatcaaattcttgttggtttt
gcggcagaaacagaacatgtaatcaagtatggtcaggataaagtggctaaaaaaaatcta
gatatgcttgtagccaatgatgtaagcaaatcgaatgcaggttttaatgtagatacaaat
gaaggctattttttatatcctgataaagagcctaaagaaatgcctaatatgaaaaaatct
gatcttgctcgacatatccttatagaagttattgatttagtagcaaacaaagctgacata
aattaa

DBGET integrated database retrieval system