KEGG   Veillonella parvula: Vpar_0845
Entry
Vpar_0845         CDS       T01130                                 

Definition
(GenBank) S-adenosylmethionine synthetase
  KO
K00789  S-adenosylmethionine synthetase [EC:2.5.1.6]
Organism
vpr  Veillonella parvula
Pathway
vpr00270  Cysteine and methionine metabolism
vpr01100  Metabolic pathways
vpr01110  Biosynthesis of secondary metabolites
vpr01230  Biosynthesis of amino acids
vpr01240  Biosynthesis of cofactors
Brite
KEGG Orthology (KO) [BR:vpr00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00270 Cysteine and methionine metabolism
    Vpar_0845
Enzymes [BR:vpr01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.6  methionine adenosyltransferase
     Vpar_0845
SSDB
Motif
Pfam: S-AdoMet_synt_C S-AdoMet_synt_M S-AdoMet_synt_N
Other DBs
NCBI-ProteinID: ACZ24526
UniProt: D1BMB9
LinkDB
Position
986901..988091
AA seq 396 aa
MAEKHMFFTSESVTEGHPDKIADQISDAVLDAIIEKDPTARVACETLVTTGLVHVVGEIS
THTYVDIPRIVRDTIREIGYTRAKFGFDCDTCGVLVSIDEQSADIAMGVDEALESKDGNG
EVLDKIGAGDQGMMFGYASNETPELMPLPISLAHRLSRRLTEVRKDGTLTYLRPDGKTQV
TVEYVDGKPKRIDTIVISTQHSPEVTQEQIKADLKRYVIDAALPAEFVDENTKYFINPTG
RFVIGGPHGDAGLTGRKIIVDTYGGMARHGGGAFSGKDPSKVDRSAAYAARYVAKNVVAA
GLADKCEVQVAYAIGVAHPVSILVDTFGTGRIEETKIQELVKKHFDLRPAGIIEMLDLLK
PHYRKTAAYGHFGRTDVDLPWERTDKAQILKEEAGL
NT seq 1191 nt   +upstreamnt  +downstreamnt
atggctgaaaaacatatgttttttacttctgaatctgttactgaaggccatccagataaa
atagctgaccaaatttctgatgctgttttggatgcgattattgaaaaggatccaactgct
cgtgtggcttgtgaaactttagttactactggtttagttcatgtagtaggtgaaatttct
actcatacatatgttgatattcctcgcatcgtacgtgatacaattcgtgaaattggttat
actcgtgcaaaatttggttttgattgtgatacttgtggtgtacttgtatccatcgatgaa
caatctgcggatatcgccatgggcgttgatgaagcacttgaatcaaaagatggcaatggt
gaagtgcttgataaaatcggtgctggtgaccaaggtatgatgtttggctatgcatctaat
gaaacacctgaactcatgcctttgccaatttccttggcacatcgtttatctcgtcgactt
acagaagttcgtaaggatgggactttaacttacttacgtccagacggtaaaactcaagtt
actgtagaatatgttgatggtaaacctaagcgcattgatacaattgttatttctacgcaa
catagccctgaagtgacccaagaacaaattaaagccgatttgaagcgttatgtaattgac
gcagcgttgcctgctgaattcgttgatgaaaatactaaatacttcatcaatccaactggt
cgtttcgtaattggaggccctcatggtgatgctggtttaactggccgtaaaattattgta
gatacatacggtggtatggcccgtcatggtggcggtgcattttctggtaaggatccatct
aaagtggaccgttctgcagcatacgcagcgcgttatgtagctaaaaatgttgtagcagca
ggtcttgctgataaatgtgaagtgcaagttgcttatgcaattggggttgctcatcctgta
tctattttagttgatacttttggtacaggtcgcatagaggaaacaaaaattcaagagctt
gttaaaaaacatttcgaccttcgtccagcaggaatcattgaaatgcttgatttgttaaag
cctcattatcgcaaaactgcagcgtatggtcactttggtagaactgatgtggatttacct
tgggaacgtacagataaagcacaaattctaaaagaagaagctggcttataa

DBGET integrated database retrieval system