KEGG   Veillonella parvula: Vpar_0996Help
Entry
Vpar_0996         CDS       T01130                                 

Definition
(GenBank) glutamyl-tRNA(Gln) amidotransferase, B subunit
  KO
K02434  aspartyl-tRNA(Asn)/glutamyl-tRNA(Gln) amidotransferase subunit B [EC:6.3.5.6 6.3.5.7]
Organism
vpr  Veillonella parvula
Pathway
vpr00970  Aminoacyl-tRNA biosynthesis
vpr01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:vpr00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    Vpar_0996
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:vpr03029]
    Vpar_0996
Enzymes [BR:vpr01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.6  asparaginyl-tRNA synthase (glutamine-hydrolysing)
     Vpar_0996
    6.3.5.7  glutaminyl-tRNA synthase (glutamine-hydrolysing)
     Vpar_0996
Mitochondrial biogenesis [BR:vpr03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    Vpar_0996
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GatB_N GatB_Yqey PhageMin_Tail
Motif
Other DBs
NCBI-ProteinID: ACZ24677
UniProt: D1BMS0
LinkDB All DBs
Position
complement(1152101..1153549)
Genome map
AA seq 482 aa AA seqDB search
MSSKYETVVGLEVHTELKTKSKIFCGCTTEFGGDQNTHVCPVCLGLPGAMPVLNKQVVEF
AIKVGLALNCEILNFNKFDRKNYYYPDLPKNYQTSQYDLPICLNGHLDIEVNGETKRIGI
TRIHMEEDAGKLVHSGNTISDSKSSNVDYNRTGVPLLEIVSEPDIRSGAEARAYVEKLRS
ILQYLEVSDGRMEEGSLRGDCNVSVRLRGTTEFGTRTETKNVNSLTAIQKVVEYEALRQA
KLIEAGGKVDQETRTWDDAQGITLGMRKKDEENDYRYFPEPDLVPIVITDEKIEEVRRAL
PELQDAKIERFVSEYGLSREDATILTVSRKTADFLDATVKAGADAKTVANWMLGDLSKMI
NESGLTFAESKVSPENLAGMIALIDKGTISGKIAKKVIVSMWESGKDADTIVKEEGLVQI
TDTGAIEEIVKQVIANNPQPVADFKSGNGKAIGFLVGQVMKESKGRANPGMVNELLKKFL
ND
NT seq 1449 nt NT seq  +upstreamnt  +downstreamnt
atgagtagtaaatacgaaacagtcgttggtttagaggttcatacagagcttaagactaag
tctaaaatcttctgtggttgtaccactgaattcggcggtgatcaaaatacacatgtatgc
ccagtgtgccttggcttacctggtgcaatgcctgtgttaaataaacaagtagtagaattt
gctattaaagtaggtttagcattgaattgtgaaatccttaactttaacaaatttgaccgt
aaaaactactattatcctgatttgcctaaaaactatcaaacatctcaatatgatttgcca
atttgcttaaatggtcatttagatattgaggttaatggtgaaactaaacgcatcggtatt
acccgtattcatatggaagaggatgcaggtaaactcgtccatagtggcaacactatttcc
gactctaaatcttctaatgttgactacaaccgtacgggtgtacctcttcttgaaatcgta
tctgaaccagatatccgttccggtgcagaagcgagagcatacgttgagaaattacgttct
attttgcaatatttagaagtatctgacggtcgtatggaagaaggttctttgcgtggtgac
tgtaacgtatccgtacgtttacgtggcactacagaatttggtacacgtacagaaactaaa
aatgtgaactctttaactgcaattcaaaaagttgttgaatatgaagcattgcgtcaagct
aagttaatcgaagctggcggcaaagtagatcaagaaacacgtacttgggatgatgcacaa
ggtatcacgcttgggatgcgtaaaaaagacgaagaaaacgattaccgttacttcccagaa
ccagatttggtaccaatcgtaattacagatgaaaaaatcgaagaagtacgtcgtgcactg
ccagaattacaagatgctaagattgaacgttttgtatctgaatatggcttgtctcgtgaa
gatgcaactattcttactgtatcccgtaaaacagcggacttcttagatgctactgtaaaa
gcgggtgcagatgctaagactgttgctaactggatgcttggtgacttgtccaagatgatt
aatgaaagcggtttaacatttgctgaatccaaggtaagtcctgaaaacttggctggtatg
attgccctaatcgacaaaggtacaatttcgggtaaaattgcgaaaaaagttatcgtatcc
atgtgggaatccggcaaggatgctgatactattgtaaaagaggaaggtctagttcaaatc
acagatactggtgctattgaagaaattgttaagcaagttattgctaataatccacaacca
gtagcagacttcaagagtggtaatggtaaggctataggcttcttagttggtcaagttatg
aaggaatccaaaggccgagctaatcctggaatggtaaatgaattacttaaaaaattctta
aatgactga

DBGET integrated database retrieval system