KEGG   Veillonella parvula: Vpar_1249
Entry
Vpar_1249         CDS       T01130                                 

Definition
(GenBank) succinate CoA transferase
  KO
K18118  succinyl-CoA:acetate CoA-transferase [EC:2.8.3.18]
Organism
vpr  Veillonella parvula
Pathway
vpr00020  Citrate cycle (TCA cycle)
vpr00620  Pyruvate metabolism
vpr00650  Butanoate metabolism
vpr01100  Metabolic pathways
vpr01110  Biosynthesis of secondary metabolites
vpr01120  Microbial metabolism in diverse environments
vpr01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:vpr00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Vpar_1249
   00620 Pyruvate metabolism
    Vpar_1249
   00650 Butanoate metabolism
    Vpar_1249
Enzymes [BR:vpr01000]
 2. Transferases
  2.8  Transferring sulfur-containing groups
   2.8.3  CoA-transferases
    2.8.3.18  succinyl-CoA:acetate CoA-transferase
     Vpar_1249
SSDB
Motif
Pfam: AcetylCoA_hyd_C AcetylCoA_hydro CitF
Other DBs
NCBI-ProteinID: ACZ24929
UniProt: D1BNH2
LinkDB
Position
complement(1424919..1426424)
AA seq 501 aa
MVIDIKDRVKNVDLQGKIVTAYDAAQLINPNDKVGISGFTPSGYAKVVPLALAERMEKEP
FKIDLWTGASVGDEADGALTRANGINRRFPYQTNKDMRKALNGGDVKYIDMHLSTMAQNI
RYGFFGDLDVAIIEVCQINEDGSLVPTTSVGNSPTFVSQAKKVIVEVNVSQPLSLVGMHD
IYEPLDPPHRKPIPLEQAGDRIGTEAIPCDPSKIIAVVPSDVPDTTRPLAAIDDDAKAMS
QHLIKFFEQEIAEGRLPKNLLPLQSGVGSVANAVISGLAQGPFTDLSIYTEVIQDGMFDL
IDAGKVTVCSGTALSPSPDGLKRFYANIDEYRKKIILRPQEISNNPGIARRIGVIAMNTA
IEFDIFGNVNSTHIMGSKMMNGVGGSGDFARSAYLTIFCTNSVAKNGDISSIVPYVSHVD
HPEHDTMIFCTEQGVADCRGLSPVERARLIIEKCAHPDYKPMLTEYLEKALAATKNAHTP
MLLDEALSWHKRFTETGSMKK
NT seq 1506 nt   +upstreamnt  +downstreamnt
atggtgatagacatcaaagaccgcgtaaaaaatgtggacctgcaaggtaaaattgtcact
gcttatgatgcagctcagttgattaaccctaatgataaagttggtatttccggctttaca
ccatcgggttatgcaaaagttgtgccattggcattggcagaaagaatggaaaaagaacca
ttcaaaattgatttgtggacaggtgcttccgtaggtgatgaagctgatggtgcgttaact
cgtgctaatggtattaatcgccgctttccatatcaaaccaataaagatatgagaaaggct
ttaaatggtggagatgttaaatacatcgatatgcatttaagcacaatggcacaaaatatt
cgttatggatttttcggggatttagatgtagcaattattgaagtatgtcaaatcaacgaa
gatggttctttagtaccgactacttctgttggtaattctccaacatttgttagtcaagct
aaaaaggttatcgtagaggtaaatgtatctcaaccattatctttagttggtatgcatgat
atctatgaaccgttggatccaccacatcgtaaaccaattccgttggaacaggccggcgat
cgtatcggtacagaagcaataccttgtgatcctagcaaaatcattgctgtggttccaagt
gatgtacctgatacaacaagacctttagctgctattgatgatgatgcaaaggcaatgagt
caacatcttatcaaattctttgaacaagaaattgcagaaggtcgtttgcctaaaaacttg
cttccattgcaatccggcgtgggctctgtagcaaatgcggtaatcagtggcttggctcaa
gggcctttcacagatttatctatttatacagaagtaattcaagacggtatgtttgactta
atcgatgctggtaaagtaactgtatgttccggtactgcattgagtccctctccagatgga
ttgaaacgtttctatgcgaatattgatgaatatcgtaaaaaaataattcttcgtccgcaa
gaaatttccaataaccctggtattgctcgtcgtattggtgtcattgccatgaataccgct
atcgaatttgatatttttggcaatgtaaattctactcatattatgggtagcaaaatgatg
aatggtgttggtggttctggtgattttgcacgtagtgcatatctcactatcttctgtact
aactccgttgctaaaaatggcgacatcagttctatcgttccatatgtatcccatgtggat
catccagaacatgacactatgattttctgtacagaacaaggtgttgctgactgtcgtggt
ttaagtccagtggaaagagctcgtttgattattgaaaaatgtgctcacccagactacaaa
cctatgttaactgaatacctagaaaaagcattagctgcaacaaagaatgcccatacacca
atgttgcttgatgaagctctttcttggcataaacgcttcacagaaactggaagcatgaaa
aaataa

DBGET integrated database retrieval system