KEGG   Veillonella parvula: Vpar_1534
Entry
Vpar_1534         CDS       T01130                                 

Definition
(GenBank) ATP synthase F1, alpha subunit
  KO
K02111  F-type H+/Na+-transporting ATPase subunit alpha [EC:7.1.2.2 7.2.2.1]
Organism
vpr  Veillonella parvula
Pathway
vpr00190  Oxidative phosphorylation
vpr01100  Metabolic pathways
Module
vpr_M00157  F-type ATPase, prokaryotes and chloroplasts
Brite
KEGG Orthology (KO) [BR:vpr00001]
 09100 Metabolism
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    Vpar_1534
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   00194 Photosynthesis proteins [BR:vpr00194]
    Vpar_1534
Enzymes [BR:vpr01000]
 7. Translocases
  7.1  Catalysing the translocation of hydrons
   7.1.2  Linked to the hydrolysis of a nucleoside triphosphate
    7.1.2.2  H+-transporting two-sector ATPase
     Vpar_1534
  7.2  Catalysing the translocation of inorganic cations
   7.2.2  Linked to the hydrolysis of a nucleoside triphosphate
    7.2.2.1  Na+-transporting two-sector ATPase
     Vpar_1534
Photosynthesis proteins [BR:vpr00194]
 Photosystem and electron transport system
  F-type ATPase [OT]
   Vpar_1534
SSDB
Motif
Pfam: ATP-synt_ab ATP-synt_ab_C ATP-synt_ab_N ATPase Arginosuc_synth AAA_16 AAA_7 ATPase_2 Fe_dep_repress
Other DBs
NCBI-ProteinID: ACZ25210
UniProt: D1BPA3
LinkDB
Position
complement(1747023..1748561)
AA seq 512 aa
MKMKPEEITAIIKQQIQDYDVDLNVDDVGTVLDVGDGIAHIYGLERAMAGELLELPHGVY
GLVLNLELDNVGAVLLGDDFLIKEGDQVRRTGKIMDVPAGDALIGRVVNPLGQPLDGKGA
IQATERRPIEHPAPGIADRQSVNEPLQTGLKAIDAMVPIGRGQRELIIGDRGTGKTAIAL
DTILNQKGKDVICIYVAIGQKESTVARVVQKLEEAGAMEYTIVVSASASTGAPLQYIAPY
AGVAMGEYFMYQGKHVLCVYDDLTKQAAAYRAMSLLLRRPPGREAYPGDVFYLHSRLLER
AAKLSPELGGGSITALPIIETQAGDVSAYIPTNVISITDGQIFLGTDMFYSGIRPAVDVG
LSVSRVGGSAQTKAMKQVAGQLRLDLAQYRELAAFAQFGSDLDAATRAQLDRGERLTEML
KQGQYEPMSVAEMVINLYAGTKGYLADIQVADVLSFEAELLRYVKANYPEIITNIETSKK
IDEETENLLKQAIPECVEAFGSTHTLVSRKEA
NT seq 1539 nt   +upstreamnt  +downstreamnt
atgaaaatgaagcctgaagaaatcactgctataatcaaacagcagattcaggactatgat
gttgacctcaatgtcgatgacgtgggtactgttctcgacgtaggggatggcatcgcccat
atttatggtcttgaaagagccatggccggtgagttgctagaattaccacacggcgtatat
ggcttggttttgaacttagaattagataatgttggtgccgtactattaggtgatgacttc
ttgattaaagaaggagaccaagtgcgccgtactggcaaaattatggacgttcctgctgga
gatgccttgattggtcgcgtagtaaaccctcttggtcaacctcttgatggcaagggtgct
atccaagctacagaacgtcgtcctatcgaacatccagcacctggtattgcggatcgtcaa
tccgtaaacgaaccattgcaaacaggtcttaaagcgattgatgcgatggtaccaatcggc
cgtggtcaacgtgagcttatcatcggtgaccgtggtacaggtaaaactgcgattgcctta
gatactattttgaaccaaaaaggcaaagatgttatttgtatttatgtagctattggtcaa
aaagaatctacggttgctcgtgtagtacaaaaacttgaagaagcaggggctatggaatat
acaatcgtagtttctgcgagtgcttccactggtgcacctcttcaatacattgccccatac
gctggtgttgccatgggtgaatactttatgtaccaaggtaaacacgtattatgcgtatat
gatgacttaacaaaacaagcggctgcataccgtgctatgtccctattattgcgccgtcca
ccagggcgtgaggcatatccaggtgacgtattctacttacacagccgtctattagagcgg
gctgcgaaactttcacctgaacttggtggaggttctattacagcgttgccaatcattgaa
acacaagcaggtgacgtatctgcatacatcccaacaaacgtaatttccatcaccgatggt
caaattttcttgggtacagatatgttctactctggtattcgtccagctgttgacgtaggt
ttatctgtatctcgtgtaggtggtagtgctcaaactaaagcgatgaaacaagtagcgggt
caattacgtttggaccttgctcaatatcgtgagttggctgctttcgctcagtttggttcc
gaccttgatgcggctacacgcgctcaacttgatcgtggtgaacgcttaactgaaatgtta
aaacaaggtcaatatgagcctatgagcgtagcggaaatggttattaacctttacgctggt
acaaaagggtacttagcagatattcaagtggcagatgtattgtcctttgaagctgaactt
ttacgctatgtaaaagcaaattaccctgaaatcatcactaacattgaaacgtctaagaaa
attgacgaagaaactgaaaatctattgaagcaagcaatcccagaatgtgttgaagcattt
ggctctacacatacattagtgtctcgtaaggaggcgtaa

DBGET integrated database retrieval system