KEGG   Vibrio qinghaiensis: CCZ37_06780Help
Entry
CCZ37_06780       CDS       T05259                                 

Gene name
alr
Definition
(GenBank) alanine racemase
  KO
K01775  alanine racemase [EC:5.1.1.1]
Organism
vqi  Vibrio qinghaiensis
Pathway
vqi00473  D-Alanine metabolism
vqi01100  Metabolic pathways
vqi01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:vqi00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    CCZ37_06780 (alr)
 09160 Human Diseases
  09168 Drug resistance
   01502 Vancomycin resistance
    CCZ37_06780 (alr)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:vqi01011]
    CCZ37_06780 (alr)
Enzymes [BR:vqi01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.1  Acting on amino acids and derivatives
    5.1.1.1  alanine racemase
     CCZ37_06780 (alr)
Peptidoglycan biosynthesis and degradation proteins [BR:vqi01011]
 Precursor biosynthesis
  Racemase
   CCZ37_06780 (alr)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ala_racemase_N Ala_racemase_C Virul_Fac
Motif
Other DBs
NCBI-ProteinID: ASU22310
UniProt: A0A223MXL5
LinkDB All DBs
Position
1:1477315..1478538
Genome map
AA seq 407 aa AA seqDB search
MNFKASFLTLSIAMALPSFSATTAPLSLNVSEPSIQEIQQSNTWLEIDLGQFKQNIEQFK
SHINSQTKICAVMKADAYGNGIRGLMPTILAQGIPCIAITSNAEARAVRESGFKGQLMRV
RSASIDEIAQSAEFNIEELIGSKMQAEQLAQLSQQKGKTIRVHLALNDGGMGRNGIDMST
DVGKQESIAIATQSGIQIVGIMTHFPNYNPDEIRSKLASFNTNSAWLIQQANLKRDELIL
HVANSYTALNVPEAQLDMVRPGGVLYGDLPTNPEYPSIVSFKTRIASLHHLPKGSTVGYD
STYRVTKESVLANLPVGYSDGYPRKMGNRSDVLINGQRAKVVGVTSMNTTLVDVTDVKGV
LPNQEVTLFGAQKQGRITVSELEENAELIFPELYTIWGTANPRFYIH
NT seq 1224 nt NT seq  +upstreamnt  +downstreamnt
atgaacttcaaagcctcttttcttacactgtcaattgccatggctttaccctctttttca
gcgactactgcacctttaagccttaacgtcagtgagccttctatacaagaaattcagcaa
tccaatacttggcttgagatcgatcttggccaattcaaacaaaatattgagcagtttaag
agccacatcaacagccaaactaaaatttgcgccgtgatgaaggcagatgcttacggcaac
ggtattcgcggtttaatgccaacgattctcgcgcaagggatcccttgtattgcaattacc
agtaatgcagaggcgagagccgtacgtgagagtgggtttaaaggccagttgatgcgtgtt
cgctctgcgagcattgatgaaatcgcacaaagtgccgagttcaatatcgaagagctaatc
ggtagcaaaatgcaagctgaacaactcgctcagctaagccagcaaaaaggtaaaacgata
agagtacatttggcattaaatgatggcggaatggggcgcaatggtatcgatatgtcaacc
gatgtaggaaaacaagaatcgattgcgattgctactcaaagcggcatacaaattgttggg
ataatgacgcatttccccaattacaatccagacgaaatccgcagcaagttggccagtttt
aataccaattcagcttggttgattcagcaagcaaacctaaaacgcgatgagctgattttg
catgttgccaactcctatactgctctcaatgtgccggaagcacaactcgatatggtacgt
cctggtggcgtcctatatggcgacttaccaactaacccggaatatccgtcaatcgtctca
ttcaaaacacgcattgcgtcattgcatcatcttcctaaaggaagcaccgttggctatgac
agtacataccgcgtaactaaagagagtgttttggcgaacctacctgttggctattcagat
ggttaccctagaaaaatgggcaatcgcagtgacgtattgattaacggtcaacgagcaaaa
gtggttggagtaacctcaatgaacaccacattggttgacgtaaccgatgtgaaaggcgtc
cttcctaatcaggaagtcaccttgtttggcgcgcaaaagcaaggccgaatcactgtcagt
gagctggaagaaaacgcagagctcatattccctgaactgtatacaatttggggcacggca
aaccctcgtttttacatccactaa

DBGET integrated database retrieval system