KEGG   Vibrio qinghaiensis: CCZ37_07745Help
Entry
CCZ37_07745       CDS       T05259                                 

Definition
(GenBank) glutamate decarboxylase
  KO
K01580  glutamate decarboxylase [EC:4.1.1.15]
Organism
vqi  Vibrio qinghaiensis
Pathway
vqi00250  Alanine, aspartate and glutamate metabolism
vqi00410  beta-Alanine metabolism
vqi00430  Taurine and hypotaurine metabolism
vqi00650  Butanoate metabolism
vqi01100  Metabolic pathways
vqi01110  Biosynthesis of secondary metabolites
vqi01120  Microbial metabolism in diverse environments
vqi02024  Quorum sensing
Brite
KEGG Orthology (KO) [BR:vqi00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    CCZ37_07745
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    CCZ37_07745
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    CCZ37_07745
   00430 Taurine and hypotaurine metabolism
    CCZ37_07745
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    CCZ37_07745
Enzymes [BR:vqi01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.15  glutamate decarboxylase
     CCZ37_07745
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyridoxal_deC Beta_elim_lyase Aminotran_5 SepSecS DUF5446
Motif
Other DBs
NCBI-ProteinID: ASU22493
UniProt: A0A223MYB0
LinkDB All DBs
Position
1:1694889..1696532
Genome map
AA seq 547 aa AA seqDB search
MVSEQKTANVSFESLLRIFTVPEGPDSTLTKIDQELSRNLNLFLREHIVAEEKPLKEIEK
DFSNPQIPESPAFVSEHTQHLLDNLVAHSVHTSAPSFIGHMTSALPYFLMPLSKIMIALN
QNLVKIETSKAFTPLERQVLGMLHRLIYQENDAFYSQWMHSANHSLGAFCSGGTIANITA
LWVARNNALKADGDFQGVEKEGLFKAMRHYGYHGLAILVSDRGHYSLKKAADVLGIGQEG
LVCVKTDHNNRLCPQDLKAKMAHLKSQKIKPFAVVGVAGTTETGNIDPLRDIANICQQEG
CHFHVDAAWGGATLMSNNYRYLLNGIELADSVTIDAHKQLYVPMGAGMVLFKKPDAMHSI
EHHAQYILRKGSKDLGSHTLEGSRSGMAMLVYASMHIISRPGYELLIDQSIAKARYFADL
IKAQDDFELVSEPELCLLTYRYIPALVRQALQQALPNQKAELNELLNEITQFVQKKQRET
GHSFVSRTRLNPERWDKLDTIVFRVVLANPLTTHAILHSILDEQRHIATLAPNLMAKIVQ
LAQRITS
NT seq 1644 nt NT seq  +upstreamnt  +downstreamnt
atggtatcagaacaaaaaactgcaaatgtgagtttcgagagcttgttacggatcttcact
gtgcccgaaggccccgattcaacactgacaaaaatagaccaagagctatcacgcaatttg
aacctcttcttgcgtgaacatattgtcgctgaagaaaaaccactcaaagagatcgaaaaa
gatttctctaatccgcaaattccagagtcaccggcgttcgtttcagaacatactcaacat
ttgttggataatttagtcgctcattcggtacatacctcggctcccagctttattggtcat
atgacatctgcactgccatatttcttgatgccgttatcaaagatcatgattgcgctgaat
caaaacttagtcaaaattgaaacgtcgaaagcgtttacaccgctagagcgacaggttttg
ggtatgttgcatcgtttgatctatcaagaaaacgacgccttttacagccaatggatgcac
agtgccaatcattcgcttggtgcattctgctctggcggaacgattgccaatatcacggca
ttgtgggtggctcgcaataatgctttgaaagccgatggtgatttccaaggcgtcgaaaaa
gaggggctttttaaagccatgcgtcattatggttaccatggtttagcgattttagtgtct
gatcgcggccattattccttaaagaaagccgctgatgtattgggtatcggccaagaaggc
ttagtttgtgtaaaaaccgaccacaacaaccgcttatgcccgcaagatttgaaagctaaa
atggcacacctaaaaagccagaaaattaaaccttttgcagttgttggcgtcgccggaacc
acagaaacaggcaacattgatcccttaagagatatcgccaatatttgccagcaagaaggt
tgtcattttcacgtagacgccgcttggggcggtgccacgttaatgtcgaacaattaccgc
tacttactcaatggtattgagttggctgactccgtaacgattgatgcacataagcagctc
tacgtgccgatgggggcaggcatggtactattcaaaaaacctgatgcaatgcattcaatt
gagcatcatgcgcaatacattttacgcaaggggtcaaaagatctcggcagtcatacattg
gaaggttctcgttcaggtatggctatgttggtgtatgctagcatgcacattattagtcgc
ccaggctacgaattattgattgaccagagtattgctaaagctcgctatttcgctgacttg
attaaagcacaagacgattttgagctagtttctgaacccgaactatgccttttaacctac
cgttatattccagcattagttcgccaagctctacagcaagccttaccaaaccaaaaggca
gaattgaacgagttgctgaacgaaataacccagtttgtgcagaaaaaacaaagggaaacg
gggcattcatttgtctctcgaacccgtttaaacccagaacgctgggacaagcttgatacc
atcgtatttcgcgtggtattggccaacccgctaacgacacatgctatcttgcactcgata
ttagatgagcagcgacatattgccactttagcccctaatttgatggctaaaattgtgcag
cttgcacaaagaattaccagctag

DBGET integrated database retrieval system