KEGG   Vibrio qinghaiensis: CCZ37_08855Help
Entry
CCZ37_08855       CDS       T05259                                 

Definition
(GenBank) superoxide dismutase [Fe]
  KO
K04564  superoxide dismutase, Fe-Mn family [EC:1.15.1.1]
Organism
vqi  Vibrio qinghaiensis
Brite
Enzymes [BR:vqi01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     CCZ37_08855
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sod_Fe_C Sod_Fe_N
Motif
Other DBs
NCBI-ProteinID: ASU22695
UniProt: A0A223MYQ9
LinkDB All DBs
Position
1:1934726..1935310
Genome map
AA seq 194 aa AA seqDB search
MSFELPALPYAKDALEPHISAETLDFHHGKHHNTYVVKLNGLIPGTEFEGKSLEEIIKTS
TGGVFNNAAQIWNHTFYWHCLAPNAGGEPTGAVADAINAAFGSFEAFKAKFTDSAINNFG
SSWTWLVKNADGSLEIINTSNAATPLTHEGVTPLLTVDLWEHAYYIDYRNLRPDYMNGFW
ALVNWVFVAENLAK
NT seq 585 nt NT seq  +upstreamnt  +downstreamnt
atgtcattcgaattaccagctttgccttacgctaaagacgctctagaaccacacatttca
gcagaaacactagatttccatcacggtaagcaccacaacacttatgttgtgaagcttaac
ggccttattcctggcactgaatttgaaggtaaatctctcgaagagatcatcaagacttca
actggtggcgtatttaataacgccgctcaaatttggaaccacaccttctattggcactgc
cttgcaccaaatgcaggtggcgaaccaacaggtgccgttgcagacgcaatcaacgccgca
tttggttcttttgaagcttttaaagcaaaattcactgactcagcgatcaataactttggt
tcatcttggacttggttggtgaaaaatgcggatggctctttagagatcatcaacacttca
aatgcagccacaccgctaactcacgaaggtgtgactccgctactgacggttgatctgtgg
gaacacgcttactacatcgattaccgtaacctacgccctgactacatgaatggtttctgg
gcactggttaactgggtattcgttgcagaaaacctagcaaaataa

DBGET integrated database retrieval system