KEGG   Vibrio qinghaiensis: CCZ37_14775Help
Entry
CCZ37_14775       CDS       T05259                                 

Definition
(GenBank) alpha-amylase
  KO
K01176  alpha-amylase [EC:3.2.1.1]
Organism
vqi  Vibrio qinghaiensis
Pathway
vqi00500  Starch and sucrose metabolism
vqi01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:vqi00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    CCZ37_14775
Enzymes [BR:vqi01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.1  alpha-amylase
     CCZ37_14775
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Alpha-amylase hDGE_amylase ENT
Motif
Other DBs
NCBI-ProteinID: ASU23846
UniProt: A0A223N2C4
LinkDB All DBs
Position
2:341677..343038
Genome map
AA seq 453 aa AA seqDB search
MTNVQPTDVILHAFDWPYRLVAERAEQIFQLGYKTVLISPPMKSFKTAQGTKWWQRYQPQ
DYRIIDNQLGNTHDFKQMVQTLTALGLRIYADVVFNHMANESKLRLDLQYPSTQDLASYQ
NKSDEYQALRLFGDLTQPLFDKDDFVEAFGIKDWKDRWQVQNGRITGGAHDPGLPTLRDN
EHVVVQQQAYLRALKALGVKGFRIDAAKHMSIEHLKKVWADDITQGMHIFGEIITDGGAT
KEEYQLFLEPYLQETKLGAYDFPLFQTVYDALQTKGSLKWLIDPYCFGQALSNNRAITFA
ITHDIPNNAVFADLVMDEALENIAYSYILGRDGGVPLIYTDLNTSGIMNHAGLPRWQEAW
CSPQMSACIAFHNKMHALPMETLEASDDLLVFSRGNEGIVVLNKSQRSQRVEIDWTNPML
ELFTKQQYQPNNQKIVMDIAARSSAMLCRLSNV
NT seq 1362 nt NT seq  +upstreamnt  +downstreamnt
atgacaaatgttcaaccaaccgatgtgattttgcatgcttttgattggccgtatcgttta
gtcgctgagcgtgcagagcaaattttccaactgggttataaaacggtgttgatttcaccg
ccgatgaaatcgttcaaaaccgctcaaggtacaaaatggtggcaacgttaccagccgcaa
gattatcgcatcattgataaccaactgggcaatacccatgattttaaacaaatggttcaa
accttaaccgcattaggcttgcgaatttatgccgatgtggtgttcaaccatatggccaac
gaatccaaattgcgtttggatttacaatacccgagcacacaagacttagcttcctaccag
aataaaagcgatgagtaccaagcgctgcgcctctttggtgatctgacccagccactcttt
gataaagatgactttgtggaagcgtttggtataaaagattggaaggatcgttggcaagtg
caaaatggccgcattactggaggggcgcatgatccgggcctacccacgttgcgtgataat
gaacacgtggttgtacaacaacaggcttatttaagggcgttgaaagcgttaggagtcaaa
ggatttcgaattgatgctgctaagcatatgtctattgagcatttgaagaaagtatgggcc
gatgacattacgcaaggcatgcatatttttggcgagatcattactgatggcggtgcaacc
aaggaagagtaccaactttttctagagccttatctgcaagaaacaaagttgggtgcttat
gattttccactatttcaaacggtgtacgatgcgttacaaacaaaaggtagcctgaaatgg
ctgattgacccttattgttttggtcaggcgctttccaacaaccgagcgattacgtttgcc
attacgcatgatatccccaacaacgctgtgtttgccgacctcgtcatggatgaagcctta
gaaaatatcgcctacagctacattcttggtcgcgatgggggagtgccattaatttacacc
gatttgaacaccagtggtattatgaaccatgctggtcttccgcgctggcaagaggcatgg
tgttcgccacaaatgtcggcgtgtattgcttttcataataaaatgcatgcattgccaatg
gaaacgctagaagcgagtgatgacctgttagtgttcagccgcggtaacgaagggatagtg
gttttgaataaatctcaacgcagtcagcgtgttgaaattgattggacaaatccaatgcta
gagctgtttacaaagcagcagtatcaacccaataaccaaaagattgtcatggatatcgcc
gctcgctctagcgcgatgctttgtcggctatcaaatgtctga

DBGET integrated database retrieval system