KEGG   Vibrio qinghaiensis: CCZ37_15640Help
Entry
CCZ37_15640       CDS       T05259                                 

Definition
(GenBank) D-alanine--D-alanine ligase A
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
vqi  Vibrio qinghaiensis
Pathway
vqi00473  D-Alanine metabolism
vqi00550  Peptidoglycan biosynthesis
vqi01100  Metabolic pathways
vqi01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:vqi00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    CCZ37_15640
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    CCZ37_15640
 09160 Human Diseases
  09175 Drug resistance: Antimicrobial
   01502 Vancomycin resistance
    CCZ37_15640
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:vqi01011]
    CCZ37_15640
Enzymes [BR:vqi01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     CCZ37_15640
Peptidoglycan biosynthesis and degradation proteins [BR:vqi01011]
 Precursor biosynthesis
  Amino acid ligase
   CCZ37_15640
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N ATP-grasp CPSase_L_D2 ATPgrasp_ST
Motif
Other DBs
NCBI-ProteinID: ASU23997
UniProt: A0A223N2F4
LinkDB All DBs
Position
2:537031..538035
Genome map
AA seq 334 aa AA seqDB search
MTQTTILLLCGGGSSEHEVSLVSANYLQAQLEKTEGFQVIRVEMRPDGWYSEKGDLSFLD
TNAATLNTNGVAVNIDFVVPCIHGYPGETGDIQSMLELAGIPYLGCGPEASANSFNKITS
KLWYDALGIPNTPYLFLSENNAQAHQECKQALEKWGSVFIKAARQGSSVGCYKVTEVSQL
NSAIDAAFSYSEQVLVEKAVKPRELEVAAYQLDGVLYLSKPGEIIAPEDAFYTYEEKYSA
TSHSMTEVQAQNLTRDQLEMISDCAARVFTHMKLRHLARIDFFLTPEGNIYLNEVNTFPG
MTPISMFPKMLEHNGHRFHEFLANCVTTSLNQKL
NT seq 1005 nt NT seq  +upstreamnt  +downstreamnt
atgactcaaacaacaatcctattattatgtggtggcggttcgtcagaacatgaagtttca
cttgtgtcagccaactatttacaagcacaacttgaaaaaacagaaggttttcaagttatt
cgcgtcgaaatgcgacccgatggttggtacagtgaaaagggcgatctgagtttcttagat
accaatgctgcaacgttgaataccaatggtgtcgccgtcaatatcgattttgtggttcct
tgcattcatggttatccaggggaaacgggcgacattcaatctatgctcgagctggctggc
atcccatatttaggttgtggtccagaagccagtgctaacagttttaataaaattacatct
aagctttggtacgatgcgctgggcattcctaatacaccttatctttttctttcagaaaat
aatgcacaagcgcatcaagagtgtaagcaggccctggaaaaatggggaagtgtgtttatt
aaagcggcgagacaaggctcatcggttggttgttacaaagtcaccgaggtttcacagctc
aacagcgcaatcgatgcggcttttagctactcggaacaagttctggttgaaaaagcagtg
aaacctagggaattagaagttgccgcttatcagcttgacggtgttttatatctttctaag
ccgggtgagatcatcgcaccagaagacgcattttatacttatgaagaaaaatacagtgcg
actagccattcgatgactgaagtacaagctcagaatttaaccagagatcaattagaaatg
ataagtgattgtgctgctagggtttttacccacatgaagcttaggcaccttgcacgtatt
gatttctttttaaccccagagggaaacatttatcttaatgaagttaacaccttcccaggc
atgactcccatttcaatgtttcctaaaatgttagagcataatgggcataggtttcatgaa
tttctagccaattgcgtgacaacgtcactcaatcaaaagctttaa

DBGET integrated database retrieval system